Protein Info for Dsui_0512 in Dechlorosoma suillum PS

Updated annotation (from data): Methylmalonyl-CoA epimerase (EC 5.1.99.1)
Rationale: Important on proprionate; this makes sense because of the utilization of the (S)-methylmalonyl-CoA formed by propionyl-CoA carboxylase (SEED_correct)
Original annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00903: Glyoxalase
  • amino acids 11 to 128 (118 residues), 21 bits, E=3.7e-08
• PF13669: Glyoxalase_4
  • amino acids 12 to 122 (111 residues), 119.4 bits, E=8.9e-39

Best Hits

KEGG orthology group: K01759, lactoylglutathione lyase [EC: 4.4.1.5] (inferred from 90% identity to tmz:Tmz1t_1139)

Predicted SEED Role

"Methylmalonyl-CoA epimerase (EC 5.1.99.1)" in subsystem Propionyl-CoA to Succinyl-CoA Module (EC 5.1.99.1)

MetaCyc Pathways

• superpathway of anaerobic energy metabolism (invertebrates) (14/17 steps found)
• methylglyoxal degradation VIII (3/3 steps found)
• propanoyl CoA degradation I (3/3 steps found)
• 2-oxobutanoate degradation I (3/4 steps found)
• methylglyoxal degradation I (2/3 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (7/10 steps found)
• pyruvate fermentation to propanoate I (4/7 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)
• 3-hydroxypropanoate cycle (7/13 steps found)
• superpathway of L-methionine salvage and degradation (9/16 steps found)
• methylaspartate cycle (11/19 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (10/18 steps found)
• superpathway of methylglyoxal degradation (2/8 steps found)
• L-glutamate degradation VIII (to propanoate) (4/11 steps found)
• ethylmalonyl-CoA pathway (3/11 steps found)
• superpathway of the 3-hydroxypropanoate cycle (7/18 steps found)
• crotonyl-CoA/ethylmalonyl-CoA/hydroxybutyryl-CoA cycle (engineered) (3/14 steps found)

KEGG Metabolic Maps

• Propanoate metabolism
• Pyruvate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 4.4.1.5

Use Curated BLAST to search for 4.4.1.5 or 5.1.99.1

Sequence Analysis Tools

See G8QFB6 at UniProt or InterPro

Protein Sequence (158 amino acids)

>Dsui_0512 Methylmalonyl-CoA epimerase (EC 5.1.99.1) (Dechlorosoma suillum PS)
MSQRPFKVLGIQQIAIGGPSKDKLKTLWVDMLGLEVTGNFVSERENVDEDICAMGKGPFK
VEVDLMQPLDPEKKPAVHTTPLNHVGLWIDDLPKAVEWLTANGVRFAPGGIRKGAAGFDI
CFLHPKGNEESPIGGEGVLIELVQAPAEVVDAFAKLAG