Protein Info for Dsui_0512 in Dechlorosoma suillum PS
Updated annotation (from data): Methylmalonyl-CoA epimerase (EC 5.1.99.1)
Rationale: Important on proprionate; this makes sense because of the utilization of the (S)-methylmalonyl-CoA formed by propionyl-CoA carboxylase (SEED_correct)
Original annotation: hypothetical protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K01759, lactoylglutathione lyase [EC: 4.4.1.5] (inferred from 90% identity to tmz:Tmz1t_1139)Predicted SEED Role
"Methylmalonyl-CoA epimerase (EC 5.1.99.1)" in subsystem Propionyl-CoA to Succinyl-CoA Module (EC 5.1.99.1)
MetaCyc Pathways
- superpathway of anaerobic energy metabolism (invertebrates) (14/17 steps found)
- methylglyoxal degradation VIII (3/3 steps found)
- propanoyl CoA degradation I (3/3 steps found)
- 2-oxobutanoate degradation I (3/4 steps found)
- methylglyoxal degradation I (2/3 steps found)
- anaerobic energy metabolism (invertebrates, mitochondrial) (7/10 steps found)
- pyruvate fermentation to propanoate I (4/7 steps found)
- (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)
- 3-hydroxypropanoate cycle (7/13 steps found)
- superpathway of L-methionine salvage and degradation (9/16 steps found)
- methylaspartate cycle (11/19 steps found)
- 3-hydroxypropanoate/4-hydroxybutanate cycle (10/18 steps found)
- superpathway of methylglyoxal degradation (2/8 steps found)
- L-glutamate degradation VIII (to propanoate) (4/11 steps found)
- ethylmalonyl-CoA pathway (3/11 steps found)
- superpathway of the 3-hydroxypropanoate cycle (7/18 steps found)
- crotonyl-CoA/ethylmalonyl-CoA/hydroxybutyryl-CoA cycle (engineered) (3/14 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 4.4.1.5
Use Curated BLAST to search for 4.4.1.5 or 5.1.99.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See G8QFB6 at UniProt or InterPro
Protein Sequence (158 amino acids)
>Dsui_0512 Methylmalonyl-CoA epimerase (EC 5.1.99.1) (Dechlorosoma suillum PS) MSQRPFKVLGIQQIAIGGPSKDKLKTLWVDMLGLEVTGNFVSERENVDEDICAMGKGPFK VEVDLMQPLDPEKKPAVHTTPLNHVGLWIDDLPKAVEWLTANGVRFAPGGIRKGAAGFDI CFLHPKGNEESPIGGEGVLIELVQAPAEVVDAFAKLAG