Protein Info for Dsui_0506 in Dechlorosoma suillum PS

Annotation: diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 733 transmembrane" amino acids 27 to 45 (19 residues), see Phobius details amino acids 60 to 83 (24 residues), see Phobius details amino acids 92 to 110 (19 residues), see Phobius details amino acids 130 to 152 (23 residues), see Phobius details amino acids 164 to 182 (19 residues), see Phobius details amino acids 201 to 219 (19 residues), see Phobius details amino acids 231 to 250 (20 residues), see Phobius details amino acids 262 to 281 (20 residues), see Phobius details PF17159: MASE3" amino acids 60 to 284 (225 residues), 231.2 bits, see alignment E=1.9e-72 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 303 to 466 (164 residues), 136.6 bits, see alignment E=3.4e-44 PF00990: GGDEF" amino acids 306 to 462 (157 residues), 161.1 bits, see alignment E=3e-51 PF00563: EAL" amino acids 483 to 718 (236 residues), 256.8 bits, see alignment E=2.7e-80

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFB0 at UniProt or InterPro

Protein Sequence (733 amino acids)

>Dsui_0506 diguanylate cyclase (GGDEF) domain-containing protein (Dechlorosoma suillum PS)
MSRPLPILSTPAAAPPEAAPLTRYSPIPWGLVIVLSLLFVVVWLLPPLGGLKQSDTIFPL
TLHTVMESFSFVVSVLVFAVSWHAYSRERAGNLMILACGFLAVALLDFGHTLSYRGMPDF
VTPSSPQKAITFWLAARYVAALTLLTIALRPWQPLARPRDRYRLMLWALLVTAAVFVSEL
YLPDFWPTMFVPGVGLTGLKIAAEYGLIAILGATAVILYPKTQGKPAFDAANLFTAVLIT
ILSELCFTLYSNVNDVFQLLGHTYKVIAYFWIYKAVFVSSVRDPYLRLSLEMAERQAAEA
RIQFLAYHDPLTELPNRILVRERFERAAERARVQSSRVGLVYIDLDNFKTVNDSLGHTLG
DLLLQGIGQRLQSLVPAGSTVSRQGGDEFLILLEDVERPREVESLVNRIVEQMQQPFAIQ
DHDLSTSVSIGVSLFPDDGGDFDTLLKKADTAMYRAKGAGRNGYRFFDREMDKDVGERLR
LSNDLRLALARNEFVLHYQPQIDLRTQEVIGAEALIRWQHPELGLLAPCRFIGIAEDTGL
IVPIGEWVIRMACHQAAAWQRAGLPPLVVAVNLSAVQFMRGDLVGTVASALATSALPSRC
LELELTESILIQDAENILGTVQRLNAIGVQMSIDDFGTGYSSLSYLKRFAVDKLKVDQSF
VRDLCSDPDDAAIVRAIIQLARSLGLKTIAEGVETAEILALLQELGCDEAQGYYFAKPLP
ADNFSAFLSQRLS