Protein Info for Dsui_0484 in Dechlorosoma suillum PS

Annotation: Holliday junction DNA helicase, RuvB subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 PF05496: RuvB_N" amino acids 35 to 193 (159 residues), 278.3 bits, see alignment E=5e-87 TIGR00635: Holliday junction DNA helicase RuvB" amino acids 38 to 341 (304 residues), 495.8 bits, see alignment E=2e-153 PF07728: AAA_5" amino acids 69 to 187 (119 residues), 28.1 bits, see alignment E=5.4e-10 PF00004: AAA" amino acids 70 to 192 (123 residues), 75.8 bits, see alignment E=1.3e-24 PF17864: AAA_lid_4" amino acids 196 to 269 (74 residues), 117.4 bits, see alignment E=5.5e-38 PF05491: RuvB_C" amino acids 271 to 340 (70 residues), 78.7 bits, see alignment E=7.6e-26

Best Hits

Swiss-Prot: 85% identical to RUVB_DECAR: Holliday junction ATP-dependent DNA helicase RuvB (ruvB) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K03551, holliday junction DNA helicase RuvB (inferred from 85% identity to dar:Daro_4060)

MetaCyc: 71% identical to Holliday junction branch migration complex subunit RuvB (Escherichia coli K-12 substr. MG1655)
3.1.22.4-RXN [EC: 3.1.21.10]

Predicted SEED Role

"Holliday junction DNA helicase RuvB" in subsystem DNA-replication or RuvABC plus a hypothetical

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.21.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QF88 at UniProt or InterPro

Protein Sequence (360 amino acids)

>Dsui_0484 Holliday junction DNA helicase, RuvB subunit (Dechlorosoma suillum PS)
MIETDSFDSSFDADAGRLIGAESKSAQEEAIERALRPKRLADYVGQAKIREQLSIFIHAA
KRRSEALDHVLLFGPPGLGKTTLAHIVAAEMGVNLRQTSGPVLERAGDLAAILTNLEPHD
VLFIDEIHRLSPVVEEILYPALEDFQIDIMIGEGPAARSVKLDLPPFTLVGATTRAGMLT
NPLRDRFGIVARLEFYNAQELTHIVTRSAQLLNVAIEPEGALEIARRSRGTPRIANRLLR
RVRDYAEVKADGIITREVADAALSMLDVDHGGLDLMDRKLLSAVIDKFAGGPVGVDNLAA
AIGEARDTIEDVLEPYLIQQGYLQRTPRGRIATPAIYRHLGLEAPGTPAATPDLWSPKEQ