Protein Info for Dsui_0453 in Dechlorosoma suillum PS

Annotation: nicotinate/nicotinamide nucleotide adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 TIGR00125: cytidyltransferase-like domain" amino acids 10 to 73 (64 residues), 45.9 bits, see alignment E=4.8e-16 PF01467: CTP_transf_like" amino acids 12 to 151 (140 residues), 80.3 bits, see alignment E=8e-27 TIGR00482: nicotinate (nicotinamide) nucleotide adenylyltransferase" amino acids 12 to 218 (207 residues), 169.5 bits, see alignment E=9.1e-54

Best Hits

Swiss-Prot: 64% identical to NADD_DECAR: Probable nicotinate-nucleotide adenylyltransferase (nadD) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K00969, nicotinate-nucleotide adenylyltransferase [EC: 2.7.7.18] (inferred from 64% identity to dar:Daro_0169)

Predicted SEED Role

"Nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.7.7.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPL1 at UniProt or InterPro

Protein Sequence (224 amino acids)

>Dsui_0453 nicotinate/nicotinamide nucleotide adenylyltransferase (Dechlorosoma suillum PS)
MATMPEQRPIGVFGGTFDPIHHGHLRLAQEALENLDLAQVRWIPAGRPPHRAEPRATPQQ
RLQMVRLAVQDNPAFAVDGAEVASADPSYTVLTLERLRRECGPAQPLVLLTGADAFAGLP
TWHRWQDILALAHVAVVYRPGFSIDPAALPVELAREFQARRCSPRELQAAPAGGIATFPM
TPLAIAATQIRQLLAAGRSPRYLLPEAVIAYIQAQQLYLSTPSN