Protein Info for Dsui_0428 in Dechlorosoma suillum PS

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 617 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 295 to 317 (23 residues), see Phobius details PF17201: Cache_3-Cache_2" amino acids 39 to 242 (204 residues), 136.9 bits, see alignment E=2.3e-43 PF17203: sCache_3_2" amino acids 104 to 207 (104 residues), 37.5 bits, see alignment E=6e-13 PF17202: sCache_3_3" amino acids 110 to 207 (98 residues), 106.5 bits, see alignment E=2.3e-34 PF00672: HAMP" amino acids 317 to 366 (50 residues), 47.9 bits, see alignment 3.4e-16 PF00015: MCPsignal" amino acids 431 to 589 (159 residues), 115.6 bits, see alignment E=5.6e-37

Best Hits

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPI6 at UniProt or InterPro

Protein Sequence (617 amino acids)

>Dsui_0428 methyl-accepting chemotaxis protein (Dechlorosoma suillum PS)
MKGLGLQARFALFGFAPLVVALIVGSLALSANESRRLEADVRLRSEATAAGVIQLLQMSD
SLMGEQTRSAMKLFREKSAQLGPVSLGEAVAVGGQHPLNLRFGGRPQALETALVDSVSGI
AGGTATLFARQGQDFVRIATNVKTPEGQRAVGTLLNPQGKAYAALARGESFYGQVDILGA
PYLTGYEPIVDAGGKVVGAWYVGFKADLAGLKELIGKSVSFGSGFVVLLDGQGKPFLHSD
GVSPESIRARLQEVAGASGASHNWEAIFRPFPAWGFKVAVVYSQAEVDGAARRAALPVLL
GGLAITVALLALLTFVLRRVVLGPIRQAVRAADALAEGDLTVHLRAERDDEIGRLLQSME
RMVRRLGDIIRQVRGAADNLSSASEEVSATAQSLSQSSSQQAASVEEISATLEQSTASVA
NNTESARNTENMAGTAAKEAVAGGAAVAESVAAMQQIAGKVGIIDDIAYQTNLLALNAAI
EAARAGEHGKGFAVVAAEVRKLAERSQVAAGEIGTVAAQTVHQAEHAGELLGRIVPAIGR
TSDLVREIAAASEEQSHGIAQINSAMGQLNQATQQNAAASEELAATAEEMGAQAEELQRL
MHFFRVGREDGAGSARA