Protein Info for Dsui_0423 in Dechlorosoma suillum PS

Annotation: putative permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 transmembrane" amino acids 9 to 26 (18 residues), see Phobius details amino acids 32 to 50 (19 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details amino acids 200 to 258 (59 residues), see Phobius details amino acids 262 to 266 (5 residues), see Phobius details amino acids 270 to 290 (21 residues), see Phobius details amino acids 303 to 331 (29 residues), see Phobius details PF01594: AI-2E_transport" amino acids 16 to 341 (326 residues), 145.3 bits, see alignment E=1.3e-46

Best Hits

KEGG orthology group: None (inferred from 50% identity to rce:RC1_2451)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPI1 at UniProt or InterPro

Protein Sequence (352 amino acids)

>Dsui_0423 putative permease (Dechlorosoma suillum PS)
MQPFRSDRILGFAALGFLIVGCFLVLRPFLSAVLWAAILATTVWPVFHWVDQRLPGWRNT
SALLTTLATALVLVAPFIVVAVGLGSNVAELAAATRTLLEGGLPDAPQWLQDIPFVGERL
HAYWQGFAHNGQRLVAELGQLVEPAKGLVLNGSRAIGMGVFHLMLSVLIVFFLFRDGEAV
TAHLTAVLERLAGARGRRLLHLAHGTVGGVVYGIIGTALAQGVLAGIGFAVAGVPGALLL
GLATFFLSAVPVGPPLIWGPAAFWLFQQGELGWAIFVAAWGFFVVSTVDNVLKPLIISRG
ASLPFILVLLGVLGGVLAFGFIGVFLGPTLLAVGYRLMTEWTAGLAEGMPRE