Protein Info for Dsui_0412 in Dechlorosoma suillum PS

Annotation: ABC-type dipeptide/oligopeptide/nickel transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 9 to 30 (22 residues), see Phobius details amino acids 99 to 122 (24 residues), see Phobius details amino acids 134 to 161 (28 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 242 to 266 (25 residues), see Phobius details amino acids 285 to 306 (22 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 75 (75 residues), 40.3 bits, see alignment E=3.3e-14 PF00528: BPD_transp_1" amino acids 113 to 315 (203 residues), 122.6 bits, see alignment E=1.6e-39

Best Hits

Swiss-Prot: 37% identical to GSIC_PECAS: Glutathione transport system permease protein GsiC (gsiC) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 85% identity to mms:mma_1402)

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPH0 at UniProt or InterPro

Protein Sequence (317 amino acids)

>Dsui_0412 ABC-type dipeptide/oligopeptide/nickel transport system, permease component (Dechlorosoma suillum PS)
MFAYILKRLIYAIPIALSVTVVSFVLVYLAPGDPLNAIAPADAPEEVIQALKSAYGLDKP
VPVQYGLWLMRAVQGDLGLSIASGREVTAEVLSAVSNTLLLAGMAAAIGVVLGCILGALA
GYRHGTWIDKAATALSVVGVSIPHYWLGLVLTILFSIWLPWFPAMGAGPGGSGEWLWDLE
HLRYLVLPALTLSVIPMGIITRTVRALVADMLGQEFVTALRARGLSGGAVFRHVAKNTAP
TVLAVAGLQIGYLMGGSILVETVFAWPGTGFLLNTAIFQRDIPLLQGTILVLCMFFVVLN
LLVDILQPLIDPRMGRS