Protein Info for Dsui_0411 in Dechlorosoma suillum PS

Annotation: ABC-type dipeptide transport system, periplasmic component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 536 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF00496: SBP_bac_5" amino acids 78 to 417 (340 residues), 260.3 bits, see alignment E=1.5e-81

Best Hits

KEGG orthology group: K02035, peptide/nickel transport system substrate-binding protein (inferred from 85% identity to mms:mma_1401)

Predicted SEED Role

"Dipeptide-binding ABC transporter, periplasmic substrate-binding component (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) or Bacterial Chemotaxis (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPG9 at UniProt or InterPro

Protein Sequence (536 amino acids)

>Dsui_0411 ABC-type dipeptide transport system, periplasmic component (Dechlorosoma suillum PS)
MKPRNFKLRHWLAALPLSFALHAGLHAETVARYGISMADIPLTTGQPDRGAGAYQFTGHT
LYDPLIAWEANVGNRPGKLVPGLATEWKADPKDNKKWRFTLRKGVKFHDGSEFTADAVIW
NLDKVLAEKSPQFDAKQSAQVRPRIPSIASYRKVGPYEVEITTKEVDALFPYQLPWFLVS
SPAQWEKLGKDWNKVASQPSGTGPFKLDKLVPRERADLVKNAAYWDKSRLPKTDRIVLLP
IPDAMTRANALLNGQVDIIETPPPDVLPQLKAGGFKLVQNVTPHVWPYHFSTYPGSPWTD
IRVRKAANLAIDRDAVVKLMSGLATPAKGQVDATSPWFGKPNFKIGYDLAAARALMAQAG
YGPSKPLKAKVIIAQGGTGQMLSLPMNEFVQQSLAEIGIEVTFEVVELENLYRHWRAGAK
ADINAGKGITAINLGYVTADPFYAITRFTDSHYVAPNGVNWGGYNNPKVDAALEKIRTTF
DSKTQDGLLAFVHQSMVDDAQMLWVVHDVNPHALSPKVKEFIQAQHWFQDLTTIRM