Protein Info for Dsui_0407 in Dechlorosoma suillum PS

Annotation: protein-L-isoaspartate carboxylmethyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 PF01135: PCMT" amino acids 13 to 202 (190 residues), 151.2 bits, see alignment E=1.6e-47 PF00398: RrnaAD" amino acids 68 to 125 (58 residues), 33 bits, see alignment E=1.7e-11 PF13489: Methyltransf_23" amino acids 72 to 159 (88 residues), 31.4 bits, see alignment E=6.6e-11 PF05175: MTS" amino acids 73 to 153 (81 residues), 30.2 bits, see alignment E=1.5e-10 PF06325: PrmA" amino acids 74 to 153 (80 residues), 23.3 bits, see alignment E=1.9e-08 PF13847: Methyltransf_31" amino acids 82 to 157 (76 residues), 34.8 bits, see alignment E=6.4e-12 PF13649: Methyltransf_25" amino acids 85 to 166 (82 residues), 43.3 bits, see alignment E=2.2e-14 PF08241: Methyltransf_11" amino acids 86 to 165 (80 residues), 31.2 bits, see alignment E=1.3e-10

Best Hits

Swiss-Prot: 42% identical to PIMT_METMJ: Protein-L-isoaspartate O-methyltransferase (pcm) from Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)

KEGG orthology group: K00573, protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC: 2.1.1.77] (inferred from 65% identity to app:CAP2UW1_1149)

Predicted SEED Role

"Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77)" in subsystem Ton and Tol transport systems (EC 2.1.1.77)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.77

Use Curated BLAST to search for 2.1.1.77

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QP22 at UniProt or InterPro

Protein Sequence (221 amino acids)

>Dsui_0407 protein-L-isoaspartate carboxylmethyltransferase (Dechlorosoma suillum PS)
MEQVQNMEQARFNMIEQQIRPWNVLDQDVLDLLSEVRREEFVPAAHQALAFADLEIPLGE
GAVMLAPKMEAKLLQELAVQPKDKVLEIGTGSGYMAALLAAKADQVTSVEISPAIAKTAK
ANLAKAGISNVSVEVGDGVHGWAAGAPYDVIVVSGSLPVVPEELLQQLKVGGRMAVFVGE
APVMEAQIVTRTGETTFASLNLFETVVAPLQNAPAKERFRF