Protein Info for Dsui_0406 in Dechlorosoma suillum PS

Annotation: Rhodanese-related sulfurtransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 38% identical to RHODA_ALLVD: Sulfurtransferase Alvin_2599 (rhd_2599) from Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)

KEGG orthology group: None (inferred from 58% identity to dar:Daro_3925)

MetaCyc: 38% identical to rhodanese 2599 (Allochromatium vinosum)
2.8.1.-

Predicted SEED Role

No annotation

MetaCyc Pathways

sulfur oxidation IV (intracellular sulfur) (3/7 steps found)
superpathway of sulfide oxidation (phototrophic sulfur bacteria) (5/12 steps found)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QP21 at UniProt or InterPro

Protein Sequence (107 amino acids)

>Dsui_0406 Rhodanese-related sulfurtransferase (Dechlorosoma suillum PS)
MNQLSVSSLADWLADPARPRPLLLDVRQPEELAICALPDLVAMPMATVPVRADELPRDKE
IVVICHHGGRSMQVAMFLENRGFSAIHNLSGGMHAWAQVVDPSMPTY