Protein Info for Dsui_0398 in Dechlorosoma suillum PS

Annotation: UDP-glucose-4-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 PF04321: RmlD_sub_bind" amino acids 1 to 162 (162 residues), 43.8 bits, see alignment E=7.2e-15 PF00106: adh_short" amino acids 2 to 109 (108 residues), 28.6 bits, see alignment E=3.8e-10 PF02719: Polysacc_synt_2" amino acids 3 to 182 (180 residues), 53.3 bits, see alignment E=1e-17 TIGR01179: UDP-glucose 4-epimerase GalE" amino acids 3 to 331 (329 residues), 438.5 bits, see alignment E=6.5e-136 PF01370: Epimerase" amino acids 3 to 261 (259 residues), 196.1 bits, see alignment E=2.7e-61 PF08659: KR" amino acids 3 to 131 (129 residues), 24.3 bits, see alignment E=1.1e-08 PF16363: GDP_Man_Dehyd" amino acids 4 to 324 (321 residues), 185.3 bits, see alignment E=9e-58 PF01073: 3Beta_HSD" amino acids 4 to 159 (156 residues), 63.3 bits, see alignment E=7.6e-21

Best Hits

Swiss-Prot: 62% identical to GALE_BACSU: UDP-glucose 4-epimerase (galE) from Bacillus subtilis (strain 168)

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 72% identity to app:CAP2UW1_4136)

MetaCyc: 62% identical to UDP-glucose 4-epimerase (Bacillus subtilis subtilis 168)
UDP-N-acetylglucosamine 4-epimerase. [EC: 5.1.3.7]; UDP-glucose 4-epimerase. [EC: 5.1.3.7, 5.1.3.2]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2 or 5.1.3.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QP13 at UniProt or InterPro

Protein Sequence (337 amino acids)

>Dsui_0398 UDP-glucose-4-epimerase (Dechlorosoma suillum PS)
MHILVTGGLGYIGSHTCVELLQAGHGVTILDNLSNSRADVAERIAGLGGAAPIFIEGDVR
DRQLLCRIFREQTVDAVIHFAGLKAVGESVAQPLRYYECNVGGSLVLFEAMAEAGVKTLV
FSSSATVYGDPHAVPIREDFPLRATNPYGRSKLMLEEVLADMAAADSQWRIARLRYFNPV
GAHESGLLGEAPNGIPNNLMPYVAQVAAGLRARLSVFGNDYPTPDGTGVRDFIHVVDLAQ
GHLAALAALARGEGMLTVNLGTGRGYSVLDLVRAFEAASGRTIPFDFVPRRPGDIAACYA
DPALAASLLGWTARRDLAAMCRDTWRWQQTAVTLGLV