Protein Info for Dsui_0394 in Dechlorosoma suillum PS

Annotation: sugar kinase, ribokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K00856, adenosine kinase [EC: 2.7.1.20] (inferred from 76% identity to dar:Daro_3935)

Predicted SEED Role

"Sugar kinases, ribokinase family"

MetaCyc Pathways

superpathway of purine nucleotide salvage (13/14 steps found)
adenine and adenosine salvage VI (1/1 steps found)

KEGG Metabolic Maps

Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QP09 at UniProt or InterPro

Protein Sequence (311 amino acids)

>Dsui_0394 sugar kinase, ribokinase (Dechlorosoma suillum PS)
MRALICGSIAYDNIMVFPDRFKNHILPEQIHILNVAFLVPELRREFGGCAGNIAYSLKLL
GGEPVIMATVGEDAAPYLKRLDDLGLSREHVRPVANSYTAQAFITTDLDDNQITAFHPGA
MTFSHLNSVGEAKDIGLGIVAPDGRDGMIGHAKQFAEAGIPFIFDPGQGMPMFSGHELLD
FLAQAEYATFNDYEAKLLTDRTGKSLEELAKLVKALVVTRGGEGSHIYVGGQRLDIPCVK
AEEVVDPTGCGDAYRAGLLYGIANGMDWDQIGRLAALVGAIKIARSGPQNHTFTREEIGE
QYHQAFGSRLW