Protein Info for Dsui_0390 in Dechlorosoma suillum PS

Annotation: ribosomal protein L11 methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00406: ribosomal protein L11 methyltransferase
  • amino acids 3 to 288 (286 residues), 245.2 bits, E=4.6e-77
• PF06325: PrmA
  • amino acids 3 to 294 (292 residues), 317.2 bits, E=4.3e-98
• PF05175: MTS
  • amino acids 148 to 232 (85 residues), 40.9 bits, E=5.8e-14
• PF13489: Methyltransf_23
  • amino acids 153 to 269 (117 residues), 38.5 bits, E=3.4e-13
• PF13847: Methyltransf_31
  • amino acids 163 to 244 (82 residues), 41.9 bits, E=3.2e-14
• PF13649: Methyltransf_25
  • amino acids 168 to 253 (86 residues), 44.6 bits, E=6.8e-15
• PF08241: Methyltransf_11
  • amino acids 168 to 256 (89 residues), 40.2 bits, E=1.6e-13
• PF08242: Methyltransf_12
  • amino acids 168 to 255 (88 residues), 33.3 bits, E=2.4e-11

Best Hits

Swiss-Prot: 68% identical to PRMA_DECAR: Ribosomal protein L11 methyltransferase (prmA) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K02687, ribosomal protein L11 methyltransferase [EC: 2.1.1.-] (inferred from 68% identity to dar:Daro_3937)

Predicted SEED Role

"Ribosomal protein L11 methyltransferase (EC 2.1.1.-)" in subsystem Heat shock dnaK gene cluster extended or Ribosome biogenesis bacterial (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See G8QP05 at UniProt or InterPro

Protein Sequence (295 amino acids)

>Dsui_0390 ribosomal protein L11 methyltransferase (Dechlorosoma suillum PS)
MAWLQLRCDTDAASAEALTDALMEAGALSAGIEDADAGTPEETPQFGEPGMDIAAAWDHS
RIAALFEADADAGAVLAACCAGLGLPTPPFTLETVEEQNWVQLTQSQFDPIRVSDKLWIV
PSWHETPAPDAINLILDPGMAFGTGSHPTTRLCLEWLERYVTADCSLLDYGCGSGILAIA
AARLGANPVTGVDIDPQAVDAAKANAERNGVSAHFADSREPIDGQFDILIANILANPLKA
LAPALAAHVRPGGWLALSGILVEQEEELMAIYSPWFAMAVADRREGWVCLEGRRI