Protein Info for Dsui_0374 in Dechlorosoma suillum PS

Annotation: translation elongation factor TU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 TIGR00485: translation elongation factor Tu" amino acids 1 to 396 (396 residues), 774 bits, see alignment E=2.4e-237 PF00009: GTP_EFTU" amino acids 10 to 203 (194 residues), 218.8 bits, see alignment E=7.5e-69 TIGR00231: small GTP-binding protein domain" amino acids 13 to 149 (137 residues), 56.1 bits, see alignment E=4e-19 PF03144: GTP_EFTU_D2" amino acids 227 to 296 (70 residues), 68.5 bits, see alignment E=8.4e-23 PF03143: GTP_EFTU_D3" amino acids 300 to 394 (95 residues), 134.4 bits, see alignment E=2.8e-43

Best Hits

Swiss-Prot: 96% identical to EFTU_AZOSB: Elongation factor Tu (tuf1) from Azoarcus sp. (strain BH72)

KEGG orthology group: K02358, elongation factor Tu (inferred from 96% identity to tmz:Tmz1t_3340)

Predicted SEED Role

"Translation elongation factor Tu" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>Dsui_0374 translation elongation factor TU (Dechlorosoma suillum PS)
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTILSKKFGGEAKAYDQIDAAPEEKARG
ITINTAHVEYETATRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDFPGDDIPIVKGSALKALE
GDQSDIGEPAILALADALDSYIPTPERAVDKPFLLPIEDVFSISGRGTVVTGRVERGIVK
VGEEIEIVGIKPTTKTTCTGVEMFRKLLDQGQAGDNVGVLLRGTKREEVERGQVLAKPGS
ITPHTHFTGEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGAISLPEGVEMVMPGDNIQ
MTVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE