Protein Info for Dsui_0328 in Dechlorosoma suillum PS

Annotation: fused permease/ATPase component of ABC transporter involved in Fe-S cluster assembly

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 609 transmembrane" amino acids 36 to 57 (22 residues), see Phobius details amino acids 69 to 91 (23 residues), see Phobius details amino acids 148 to 170 (23 residues), see Phobius details amino acids 176 to 196 (21 residues), see Phobius details amino acids 263 to 315 (53 residues), see Phobius details PF00664: ABC_membrane" amino acids 38 to 309 (272 residues), 152.8 bits, see alignment E=1.6e-48 PF00005: ABC_tran" amino acids 371 to 520 (150 residues), 115 bits, see alignment E=4.2e-37

Best Hits

Swiss-Prot: 46% identical to ATM1_CHAGB: Iron-sulfur clusters transporter ATM1, mitochondrial (ATM1) from Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 76% identity to dar:Daro_0348)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QNF3 at UniProt or InterPro

Protein Sequence (609 amino acids)

>Dsui_0328 fused permease/ATPase component of ABC transporter involved in Fe-S cluster assembly (Dechlorosoma suillum PS)
MRRSSSAHLPRPAGEVHAWPTIRTLFPYLWQYKWRVSAALIALVSAKLASVAVPLVFKQM
IDSLSPQETALALPVLLLLLYGGLRFGTALFTELREMLFARVTQRAVRRIALEVFRHLHS
LSLRFHLDRQTGGVSRDIERGSRSISSLISYTLYSILPTLVELGLVLGILLTHYDWVFAA
ITAASLVAYIVFTVQVSNWRIGIRRAVNEMDSAANSRAIDSLLNYETVKYFNNEDYEARR
YDSQMQQWEDAATRSQVTLSFLNLGQQAIIAAGVTLMMWRATAGVVAGTMTIGDLVLVNA
FLIQLYMPLNFLGVVYREIRQALTDIERMFKLLGENREVADAPDAIALPPGPAEVRFEAV
DFAYDAARPILHDLSFTIPSGHTLAVVGHSGAGKSTLSRLLYRFYDVSGGAIRINGLDLR
QMTQDSLRSAIGIVPQDTVLFNDTLIYNIQYGRPGATREEAIAAARAAQLEAFVESLPEK
WESRVGERGLKLSGGEKQRVAIARALLKNPPILIFDEATSALDSKTEKAIQAQLELAARG
RTTLIIAHRLSTVMEADEILVLEAGRIVERGRHAELLAAGGAYAQMWALQQQEELGAALA
DDAPSLEPA