Protein Info for Dsui_0319 in Dechlorosoma suillum PS

Annotation: acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 547 PF00501: AMP-binding" amino acids 29 to 403 (375 residues), 244.5 bits, see alignment E=1.7e-76 PF13193: AMP-binding_C" amino acids 453 to 535 (83 residues), 66.1 bits, see alignment E=4.6e-22

Best Hits

KEGG orthology group: K00666, fatty-acyl-CoA synthase [EC: 6.2.1.-] (inferred from 70% identity to hse:Hsero_1599)

Predicted SEED Role

"Medium-chain-fatty-acid--CoA ligase (EC 6.2.1.-)" (EC 6.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.-

Use Curated BLAST to search for 6.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QNE4 at UniProt or InterPro

Protein Sequence (547 amino acids)

>Dsui_0319 acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II (Dechlorosoma suillum PS)
MSMQPIQVTPSAYTYPLLIKQLLHTPLATAPQQEIVYGDKVRHTYRDLALRINRQGHALS
RLGVQGGDTVAVMDWDSHRYLECFFGVPMLGAVLQTVNVRLSPDQILYTLNHAQASVLLV
NREFLPVLAQIRGELATVKRFVLLDDEGGDLPEGFAGEYEALLIDCPDHYDFPDFDENSR
ATTFYTTGTTGLPKGVYFSHRQLVLHTLAVCSALALAPQQGGFHRDDIYMPLTPMFHVHA
WGMPYIATLAGVKQVYPGRYQPEAILKLIEKEQVTFSHCVPTILHMLLLTPYGKQVDLSR
WKVIIGGSALTTGLAKAALERGIDVFTGYGMSETCPILTLAQMEDPALLADADANVAVRV
KTGRPVPLVALRTVDAQMGDCPRDGKSAGEVVVRAPWLTQGYLYNPEASEHLWDGGWLHT
QDIGHIDPQGYLQVTDRIKDVIKTGGEWVSSLELEDLIGRHPGVSEVAVIGVPDEKWGER
PLALVVLKPEFADQVSAADIQAHVKVFADQGHISKYGVPENVRFLASLARTSVGKLNKRA
MREQLVK