Protein Info for Dsui_0311 in Dechlorosoma suillum PS

Annotation: ATP-dependent DNA helicase RecG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 691 PF17191: RecG_wedge" amino acids 25 to 174 (150 residues), 45.6 bits, see alignment E=1.5e-15 TIGR00643: ATP-dependent DNA helicase RecG" amino acids 30 to 662 (633 residues), 690 bits, see alignment E=1.8e-211 PF04851: ResIII" amino acids 270 to 429 (160 residues), 35.5 bits, see alignment E=2.4e-12 PF00270: DEAD" amino acids 274 to 434 (161 residues), 81.9 bits, see alignment E=1.2e-26 PF00271: Helicase_C" amino acids 479 to 585 (107 residues), 65.3 bits, see alignment E=1.5e-21 PF19833: RecG_dom3_C" amino acids 615 to 673 (59 residues), 47.7 bits, see alignment 3.6e-16

Best Hits

KEGG orthology group: K03655, ATP-dependent DNA helicase RecG [EC: 3.6.4.12] (inferred from 70% identity to dar:Daro_0356)

Predicted SEED Role

"ATP-dependent DNA helicase RecG (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.12

Use Curated BLAST to search for 3.6.1.- or 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QND6 at UniProt or InterPro

Protein Sequence (691 amino acids)

>Dsui_0311 ATP-dependent DNA helicase RecG (Dechlorosoma suillum PS)
MAEKKAGPAKAAKAPAKGASALQQKLGKLGLHSRNDLLLHFPLRYENETAVVPVNEAPWD
EPVQVEVRVTDVSIQFRPRRQLVARCEDDSGELWLRFLNFYGSQVKQLETARDEGRKLRV
FGEIRGGFFGSEMVHPRYKPVEEGSALPQSLTPVYPTTAGLAQSALRKLIGKALAESDLA
DTLDQAQLRALALEPFAASARLLHAPPPGVDEFALQNHRHPAWRRIKFDELLAQQLSLRR
AYLARREKGAPRLDAPGALARQLLGQLSFQLTGAQQRVWQEIARDLAEAHPMQRLLQGDV
GSGKTIVAALAACQAIECGWQAAFMAPTEILAEQHYKKLSAWLEPLGITVAWLSGSLKSA
KKKAAQQEAAAGAQLVVGTHALIQADVDFLRLGLAIVDEQHRFGVAQRLELRKKGKAGIP
HQLMMSATPIPRTLAMSYYADLDVSVIDELPPGRTPIRTKLVSDARRDEVVGAVRHAVES
GRQAYWVCPLIEESEKLDLQAAIDTHAILAEELEGLSVGLVHGRLKPDEKAATMAAFAAG
EIQVLVATTVIEVGVDVPNASLMVIEHAERFGLAQLHQLRGRVGRGAHESACVLLYATPL
SQTGRARLKIIYENTDGFEIARQDLQLRGPGEFVGARQSGVPLLRYADLEMDADLVELAR
DLAERLLRDDPPRAERHLRRWLGSREELLKA