Protein Info for Dsui_0307 in Dechlorosoma suillum PS

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 535 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details PF00015: MCPsignal" amino acids 319 to 501 (183 residues), 149.7 bits, see alignment E=3.9e-48

Best Hits

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QND2 at UniProt or InterPro

Protein Sequence (535 amino acids)

>Dsui_0307 methyl-accepting chemotaxis protein (Dechlorosoma suillum PS)
MGLKARIARAMGVVFAIFLLSTGFGLYGLHQTKETFIRHVEVDMALERAIVGMYAQGLQS
GQALRNVVLDPANKTGHGNLKKALEEFDGYYQNARALVPAEAPVAKVLQEVAALAAERRS
LIDKVVETAVGGAGSEAVALINSSETPLWRKIRGHLLDQMKAMKTQLDESKEAGIAEIER
TERLVIGLALASIVIAIVLLARVLQVVGRQLGGDPSEVMQVAEQVAAGNLTLHIANPQEG
SVMAAMASMQTRLAAMVAQIRQNADSLLASAETLARSSEEVVGRTSEQTEAVSAVAAAME
EMTVGISQVRDHSAEARSYAQESGRMAHQGNEVVGNVVQGMGRVASSVTESAQGIATLEH
ESEKIAAVVGVIKEVADQTNLLALNAAIEAARAGEQGRGFAVVADEVRKLAERTAQSTVE
IGVTVDVVRNGIQQAVEHMERGVTLVQGESGKVAEAGSTISALHGYADKVVGAVHEIGDA
LQEQSAASTEIARRIELIAQISEQNSSAVQASAGAVAQLQQLARSLSDSVHHFRT