Protein Info for Dsui_0298 in Dechlorosoma suillum PS

Annotation: Kef-type K+ ransport system, predicted NAD-binding component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 transmembrane" amino acids 39 to 62 (24 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 99 to 121 (23 residues), see Phobius details amino acids 140 to 159 (20 residues), see Phobius details amino acids 165 to 186 (22 residues), see Phobius details amino acids 193 to 213 (21 residues), see Phobius details amino acids 224 to 244 (21 residues), see Phobius details PF00520: Ion_trans" amino acids 38 to 252 (215 residues), 118.7 bits, see alignment E=2.5e-38 PF07885: Ion_trans_2" amino acids 172 to 248 (77 residues), 56.7 bits, see alignment E=1.9e-19

Best Hits

KEGG orthology group: None (inferred from 71% identity to pna:Pnap_1267)

Predicted SEED Role

"Potassium voltage-gated channel subfamily KQT; possible potassium channel, VIC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QNC3 at UniProt or InterPro

Protein Sequence (292 amino acids)

>Dsui_0298 Kef-type K+ ransport system, predicted NAD-binding component (Dechlorosoma suillum PS)
MSPAAAVHSAADSLGKPLAGWRLRLYSVVFESETRAGRLFDQCLIFAILASVAVVMADSV
HSLNARHQDLFATLEWGFTLLFTAEYLARLACLRRPWRYALSFFGLVDLLAILPTYLALL
VPEAHLLIDVRILRLLRMFRVLKLTAYLGEYQMLGSALLASRRKILVFLSVVLMIVLVMG
TLMYVVEGPANGFTSIPTAVYWAITTMTTVGFGDITPKTDVGRLISSAMMLLGWGTLAVP
TGIVTSEITAQRLQVTPTSRTCPDCLTEGLAPEAAYCQACGARLPEYRRDPA