Protein Info for Dsui_0291 in Dechlorosoma suillum PS

Annotation: tellurite resistance protein-like permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 transmembrane" amino acids 44 to 65 (22 residues), see Phobius details amino acids 81 to 102 (22 residues), see Phobius details amino acids 118 to 136 (19 residues), see Phobius details amino acids 142 to 166 (25 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 204 to 226 (23 residues), see Phobius details amino acids 238 to 256 (19 residues), see Phobius details amino acids 262 to 283 (22 residues), see Phobius details amino acids 292 to 313 (22 residues), see Phobius details amino acids 319 to 340 (22 residues), see Phobius details PF03595: SLAC1" amino acids 47 to 343 (297 residues), 190.3 bits, see alignment E=2.7e-60

Best Hits

KEGG orthology group: K03304, tellurite resistance/dicarboxylate transporter, TDT family (inferred from 55% identity to pgv:SL003B_2904)

Predicted SEED Role

"C4-dicarboxylate transporter/malic acid transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QNB6 at UniProt or InterPro

Protein Sequence (355 amino acids)

>Dsui_0291 tellurite resistance protein-like permease (Dechlorosoma suillum PS)
MGAGLIPAHPDKKQPKSDPAAFIPAARYTEPTAMTHTAPTPARLSLFPVSFFSTVMGTAG
LAIAWQKAHLVLGAPAEVGQWLRWLATAVWLLTALVYGLKFLTHRVAVLGEWRHPVRINF
FPTISIGLLLLAIAWAEDAPGLAAPIWGLGAGLHLAFTLAIMGGWLHHTHYEIKHANPAW
FIPVVGNIIVPVVGVRFAPPELSWFFFSIGLVFWLVLLTIVMYRLFFHEPLPLRLTPTLF
ILLAPPSVGCVAWMNLTGEVDAFARILLHTALFLALLLFSNVLRFLRVPFFLSSWAYSFP
LAAVTIATLAMAGRTHSTFFSALGMILLSILSLVLGLLIARTLVAIRRGEICQPE