Protein Info for Dsui_0290 in Dechlorosoma suillum PS

Annotation: SSS sodium solute transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 582 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 38 to 56 (19 residues), see Phobius details amino acids 79 to 101 (23 residues), see Phobius details amino acids 107 to 125 (19 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details amino acids 213 to 234 (22 residues), see Phobius details amino acids 294 to 318 (25 residues), see Phobius details amino acids 330 to 355 (26 residues), see Phobius details amino acids 388 to 415 (28 residues), see Phobius details amino acids 437 to 456 (20 residues), see Phobius details amino acids 462 to 485 (24 residues), see Phobius details amino acids 493 to 516 (24 residues), see Phobius details amino acids 529 to 550 (22 residues), see Phobius details PF00474: SSF" amino acids 66 to 501 (436 residues), 389.2 bits, see alignment E=1.1e-120 TIGR00813: transporter, solute:sodium symporter (SSS) family" amino acids 66 to 501 (436 residues), 198.9 bits, see alignment E=7.4e-63

Best Hits

KEGG orthology group: K14393, cation/acetate symporter (inferred from 80% identity to tmz:Tmz1t_0556)

Predicted SEED Role

"Acetate permease ActP (cation/acetate symporter)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QNB5 at UniProt or InterPro

Protein Sequence (582 amino acids)

>Dsui_0290 SSS sodium solute transporter (Dechlorosoma suillum PS)
MKKLTNTLALAGLGLLSSPVFAAALEGQAEKQATNWTAIIMFGAFVLATLWITKWAASKT
KTAADFYTAGGGITGFQNGLAIAGDYMSAASFLGISAAVFANGYDGLIYSIGFLVGWPII
MFLMAERLRNLGKFTFADVAAYRFQATPIRALAASGTLVVVAFYLIAQMVGAGQLIKLLF
GLDYWMAVVLVGILMMVYVLFGGMTATTWVQIIKAVLLLSGASFMVFMVLAKYGFSPEAL
FADAVRIKTDLAAKGLLAKALETDPSATAETVAAAAAAKGQSIMGPGSFIKDPISAISFG
MALMFGTAGLPHILMRFFTVPDGKEARKSVFWATTWIGYFYILTFIIGFGAIVLVGTNPE
FLDAKGVLKGGGNMAAIHLANAVGGNVFLGFISAVAFATILAVVAGLTLSGASAVSHDLY
ASVFRHGNVDSATEMRVSKMTTVALGIIAVVLGIAFEKQNIAFMVSLAFAIAASANFPVL
FMSVLWKDCTTKGAFYGGFLGLITAVVLTVLSKSIWVDILGNKTEIFPYASPALFSMAAG
FIGIWLFSLMDRSEQAAKERVAYLDQEIRSETGIGAAAASSH