Protein Info for Dsui_0289 in Dechlorosoma suillum PS

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 105 transmembrane" amino acids 25 to 47 (23 residues), see Phobius details amino acids 60 to 84 (25 residues), see Phobius details PF04341: DUF485" amino acids 12 to 100 (89 residues), 113.8 bits, see alignment E=1.5e-37

Best Hits

Swiss-Prot: 43% identical to YJCH_SHIFL: Inner membrane protein YjcH (yjcH) from Shigella flexneri

KEGG orthology group: None (inferred from 60% identity to eba:ebB115)

Predicted SEED Role

"Putative membrane protein, clustering with ActP" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QNB4 at UniProt or InterPro

Protein Sequence (105 amino acids)

>Dsui_0289 putative membrane protein (Dechlorosoma suillum PS)
MSQQELTKRIRANPKFHELKSKRNVFGWTLTVIMLLAYYGYIAIIAFDKALLAQKLSESG
VMTVGIPVGVGLILFTVAITGLYVRRANSEFDALTEQIVQEEMKK