Protein Info for Dsui_0279 in Dechlorosoma suillum PS

Annotation: K+-transporting ATPase, KdpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 602 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 66 to 84 (19 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details amino acids 285 to 303 (19 residues), see Phobius details amino acids 314 to 334 (21 residues), see Phobius details amino acids 367 to 387 (21 residues), see Phobius details amino acids 394 to 414 (21 residues), see Phobius details amino acids 419 to 438 (20 residues), see Phobius details amino acids 458 to 478 (21 residues), see Phobius details amino acids 524 to 545 (22 residues), see Phobius details amino acids 566 to 588 (23 residues), see Phobius details PF03814: KdpA" amino acids 12 to 596 (585 residues), 808.1 bits, see alignment E=1.5e-247 TIGR00680: K+-transporting ATPase, A subunit" amino acids 242 to 598 (357 residues), 522 bits, see alignment E=9.4e-161

Best Hits

Swiss-Prot: 67% identical to KDPA_CHRVO: Potassium-transporting ATPase potassium-binding subunit (kdpA) from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

KEGG orthology group: K01546, K+-transporting ATPase ATPase A chain [EC: 3.6.3.12] (inferred from 67% identity to cvi:CV_1599)

Predicted SEED Role

"Potassium-transporting ATPase A chain (EC 3.6.3.12) (TC 3.A.3.7.1)" in subsystem Potassium homeostasis (EC 3.6.3.12, TC 3.A.3.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.12

Use Curated BLAST to search for 3.6.3.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QNA4 at UniProt or InterPro

Protein Sequence (602 amino acids)

>Dsui_0279 K+-transporting ATPase, KdpA (Dechlorosoma suillum PS)
MSANLLLQYGFFFAVLFLLAWPLGLYMARIYRGDLPAFVAWLRPLENFCYRLAGVRHGDD
MGWRRYAGAVLAFSLLGVLAVYALQRLQLWLPFNPQAMANTTPDLAFNTAVSFVTNTNWQ
AYGGETTMSYLTQMLGLAVQNFLSAATGMAVVVALMRGFQRKEAGGIGNFWIDLVRSTLY
VLLPLSLILALALVGQGVVQSVAPYASVPLTQAVDYEQPKVGADGQPVLDAAGKPVLEAA
TAREQTLALGPAASQIAIKHLGTNGGGFFNANSSHPYENPTPVSNLLQMLAIVLIPAALC
FTFGRRVGDLRQGLAILAAMTAILVALLAVEVWAEQAGNPLFERLGMATQGSELMAGGNM
EGKEARFGISATSLFVTVTTAVSCGAVNAMHDSLTPLGGLVPMWLMQLGEVVFGGVGSGL
YGMLVFAIVGVFVAGLMIGRTPEYLGKKIEAYEMKMAAVAILATPLAVLLGTALSLMLEA
GTAGVFNPGAHGFSEVLYAFSSAANNNGSAFAGLGANTPYYNTALGLAMLFGRFTIIAAV
LAIAGSLAAKKRIPPSAGTLPTHTPLFVVLLIGTVIVVGALTFLPSLALGPVVEHLQMVG
VR