Protein Info for Dsui_0272 in Dechlorosoma suillum PS

Annotation: osmosensitive K+ channel histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 898 transmembrane" amino acids 405 to 424 (20 residues), see Phobius details amino acids 430 to 446 (17 residues), see Phobius details amino acids 453 to 471 (19 residues), see Phobius details amino acids 482 to 505 (24 residues), see Phobius details PF02702: KdpD" amino acids 25 to 234 (210 residues), 333.6 bits, see alignment E=1.1e-103 PF13493: DUF4118" amino acids 407 to 513 (107 residues), 102.3 bits, see alignment E=3.2e-33 PF13492: GAF_3" amino acids 572 to 649 (78 residues), 35.4 bits, see alignment E=3.5e-12 PF00512: HisKA" amino acids 669 to 734 (66 residues), 54.7 bits, see alignment 2.2e-18 PF02518: HATPase_c" amino acids 779 to 888 (110 residues), 88.5 bits, see alignment E=1.1e-28

Best Hits

Predicted SEED Role

"Osmosensitive K+ channel histidine kinase KdpD (EC 2.7.3.-)" in subsystem Potassium homeostasis (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QN97 at UniProt or InterPro

Protein Sequence (898 amino acids)

>Dsui_0272 osmosensitive K+ channel histidine kinase (Dechlorosoma suillum PS)
MSDPLQRPDPDALLARLEAEEIQARRGRLKIFFGASPGVGKTYAMLAAARTLQSQGVDVA
VGVVETHGRRETAELVQGLELLPSRQVEHRGRRLQEFDLDGALQRAPDLVLVDELAHSNA
PGSRHPKRWQDVEELLAAGIDVFTTVNVQHLESLNDVVGRITGARVWETVPDRLFDAADE
VVLVDLPPEELLTRLKAGKVYVPQQAERAMANFFRKGNLLALRELALRRTADRVDDDVRA
YRRDQSVSTVWPTRESLLVCIGPGPGSERLVRSAARLATQLEVPWHALYVETPRYQRLPE
GERGRVLKSLRLAQELGAETANRPGQDAAAAAIQYAREHNLGKVLLGRELPGDWRRWLPW
RTSLARRLARQAPDLDVMQVASDGVDGEAPPLPDGPARPAAVNVRGYGLAAAAVAAVTLV
ATPLHGALDLANIVMLFLLAVLFAAVKLGRNPAILAAFLSVAAFDFFFVSPRLSFAVSDV
QYLLTFSVMLAVALITAQLTAGLRFQVDVAQSRERRSDALYEMARELSAALTVEQIDDIT
RRFVQQGFQARALLLVPGQQERLSLPEGLPADLPVDLGIAQWAADHGEAAGHSTDTLPSA
PMRYLPLKAPMRTRGVLAVLPREQPWLPSPEQERLLETCATLVAIAVERVHYIEVAQEAL
VQMESERLRNGLLAALSHDLRTPLTALVGLADSLSLGGALPPAQAELAQAIRGEAMRTSA
LVHNLLDMARLQSGQVTLKKEWQPLEEVVGAALQARASVLAQHRVRVDLPADLPLLEFDA
VLMERVFCNLIENAAKYTPPGSLIEIGARREAERVLVSVSDNGPGLPPGKEAGLFEKFTR
GQDESAIPGVGLGLAIVRAIVDAHKGKVWAENRSDGPGARFVFTLPLGQPPALPTELL