Protein Info for Dsui_0269 in Dechlorosoma suillum PS

Annotation: ABC-type multidrug transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 176 to 202 (27 residues), see Phobius details amino acids 224 to 250 (27 residues), see Phobius details amino acids 259 to 283 (25 residues), see Phobius details amino acids 290 to 309 (20 residues), see Phobius details amino acids 321 to 339 (19 residues), see Phobius details amino acids 348 to 368 (21 residues), see Phobius details PF12679: ABC2_membrane_2" amino acids 16 to 371 (356 residues), 52.9 bits, see alignment E=5.2e-18 PF12698: ABC2_membrane_3" amino acids 29 to 365 (337 residues), 135.8 bits, see alignment E=3.1e-43 PF01061: ABC2_membrane" amino acids 186 to 339 (154 residues), 73.7 bits, see alignment E=2.4e-24

Best Hits

Swiss-Prot: 58% identical to YHHJ_ECOLI: Inner membrane transport permease YhhJ (yhhJ) from Escherichia coli (strain K12)

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 77% identity to tau:Tola_0592)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QN94 at UniProt or InterPro

Protein Sequence (378 amino acids)

>Dsui_0269 ABC-type multidrug transport system, permease component (Dechlorosoma suillum PS)
MDRHGTLANIFRLGLKELRSLWADKVLLVLIVWAFTGGIYSAAKGVSQELRNAPVAVVDE
DRSPLSARLIGALTPPYFKTPDLISMAQMDRALDQGRYSFSLVIPANFQRDLKEGRRPTL
QLNIDATVMSQSFIGASYIQSIVAGELNEYLTGKRDSSAPPIRLTTRVRFNPNLTGFWFG
GVMEVINNINMLTIILVGAAFIREREHGTLEHLLVMPLTPFEIMMAKVWASGAAVLLAAS
VGLIAVIQAIMQVPIAGSVPLFLCGAALYLFSAASIGIFLGTIARSMPQFGLLFILTIVP
LQLLSGGVTPRESMPEVVSDIMLGAPITYFVRLAQAILYRGAGLDTVWPEFLAITGIGAI
FFLIAHARFRKSVTQTQV