Protein Info for Dsui_0268 in Dechlorosoma suillum PS

Annotation: ABC-type multidrug transport system, ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 918 transmembrane" amino acids 566 to 586 (21 residues), see Phobius details amino acids 721 to 745 (25 residues), see Phobius details amino acids 773 to 795 (23 residues), see Phobius details amino acids 802 to 824 (23 residues), see Phobius details amino acids 830 to 850 (21 residues), see Phobius details amino acids 858 to 882 (25 residues), see Phobius details amino acids 894 to 913 (20 residues), see Phobius details PF00005: ABC_tran" amino acids 26 to 174 (149 residues), 103.4 bits, see alignment E=4e-33 amino acids 291 to 434 (144 residues), 100 bits, see alignment E=4.4e-32 PF13304: AAA_21" amino acids 140 to 204 (65 residues), 27.8 bits, see alignment 6.2e-10 PF12698: ABC2_membrane_3" amino acids 572 to 910 (339 residues), 163.8 bits, see alignment E=1.5e-51 PF12679: ABC2_membrane_2" amino acids 598 to 865 (268 residues), 39.6 bits, see alignment E=9.6e-14 PF01061: ABC2_membrane" amino acids 724 to 881 (158 residues), 53.3 bits, see alignment E=7.1e-18

Best Hits

KEGG orthology group: K13926, ribosome-dependent ATPase (inferred from 65% identity to app:CAP2UW1_2215)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QN93 at UniProt or InterPro

Protein Sequence (918 amino acids)

>Dsui_0268 ABC-type multidrug transport system, ATPase component (Dechlorosoma suillum PS)
MASLDTAAPVARLAGISLRYGQVDALADVTLDLPAGGMVGLIGPDGVGKSSLLALVAGAR
KIQTGRVEVFGEDMGSARVRPRLQPRIAYMPQGLGKNLYPTLSVAENVDFFGRLFGQGKA
ERQRRIDELLAATNLSPFRDRPAAKLSGGMKQKLGLCCALIHDPDLLILDEPTTGVDPLS
RRQFWELIDRIRARRPGMSVLVATAYMEEAERFDWLVAMDAGRIIGTGSAAELKARSGAA
TLEQAFISLLPEERRQAHSQLVIPPLPPDGHDFAIEAEGLTQRFGDFTAVDRVSFQIGKG
EIFGFLGSNGCGKTTTMKMLTGLLPPTQGKASLFGRTVDANNLETRKQVGYMSQAFSLYG
ELTVAQNLDLHARLFHLPPEKIGPRIAALSERFDLTPYADAPAADLPLGIRQRLSLAVAV
VHEPRLLILDEPTSGVDPIARDQFWALLVELSREQGVTIFISTHFMNEAERCDRISLMHA
GKVLASDTPAALQAARGADSLEAAFISYLEEASGAAPAQPQNPTPAEAQPAPTAAARAPH
RHKAFSLRRLLGYAYREALELRRDTIRLTFALLGSVLLMFVLGYGISMDVEGLRFAVLDR
DQSPESRDYIDNIAGSRYFLQQPPIADSAELERRMRDGELTVALEIPPNFGRDLHQGRSP
EVGAWVDGAMPYRGETTRGYVQGLHQQYIVKLVTEATGTAPTLTWTDVALRYRYNQDFRS
IYAMVPAVIPLLLVFIPAILMALGVVREKELGSITNLYVTPVSRLEFLIGKQLPYVVVSM
LSFFALALQAVLVFGVPIKGSFLALACGALLYVVCTTGLGLLISTFTKTQIAALFGTAIL
TMLPTVQFSGLTTPVASLVGGAYWIGQFFPATYFLVISRGVFTKALGFADLGQQFLALAC
FIPVLTLISLALLPKQEK