Protein Info for Dsui_0266 in Dechlorosoma suillum PS

Annotation: response regulator with CheY-like receiver domain and winged-helix DNA-binding domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 PF00072: Response_reg" amino acids 3 to 113 (111 residues), 90.8 bits, see alignment E=6.6e-30 PF00486: Trans_reg_C" amino acids 144 to 217 (74 residues), 76.1 bits, see alignment E=1.9e-25

Best Hits

Swiss-Prot: 45% identical to QSEB_ECOLI: Transcriptional regulatory protein QseB (qseB) from Escherichia coli (strain K12)

KEGG orthology group: K02483, two-component system, OmpR family, response regulator (inferred from 87% identity to dar:Daro_0429)

Predicted SEED Role

"Phosphate regulon transcriptional regulatory protein PhoB (SphR)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QN91 at UniProt or InterPro

Protein Sequence (227 amino acids)

>Dsui_0266 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain (Dechlorosoma suillum PS)
MRILLAEDDKIIADGLSRSLRQGGYAVDCAYTGLEADTALMTNSYDLLILDLGLPKLPGL
EVLKRLRARNVQLPVLILTALDGTGDRVKGLDLGADDYMAKPFELAELEARVRALTRRSS
GTAPVITCGALTYDQAGRVAQLDGQNLDLSARELGLLEILLSRVGRLVSKDQLVDHLCGW
GEEVSHNAIEVYIHRLRKKLESGGVRIATVRGLGYCLEKPQEPGAGR