Protein Info for Dsui_0252 in Dechlorosoma suillum PS

Annotation: TIGR00252 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 TIGR00252: TIGR00252 family protein" amino acids 21 to 132 (112 residues), 115 bits, see alignment E=1.1e-37 PF02021: UPF0102" amino acids 27 to 114 (88 residues), 98.3 bits, see alignment E=1.3e-32

Best Hits

Swiss-Prot: 58% identical to Y503_DECAR: UPF0102 protein Daro_0503 (Daro_0503) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K07460, putative endonuclease (inferred from 60% identity to app:CAP2UW1_0585)

Predicted SEED Role

"Predicted endonuclease distantly related to archaeal Holliday junction resolvase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMU1 at UniProt or InterPro

Protein Sequence (134 amino acids)

>Dsui_0252 TIGR00252 family protein (Dechlorosoma suillum PS)
MNTGAKDTTAAAPSPARDPRQADGSLAEARAAAWLEDRGLKVLARNYRVRGGEIDLVCRD
GRTTVFVEVRLRRNGDFGGAAASITRKKQQRLILAARHWLQEQGDSACRFDCVLLQGEAA
SAPLEWLKNAFDAD