Protein Info for Dsui_0251 in Dechlorosoma suillum PS

Annotation: putative S-adenosylmethionine-dependent methyltransferase, YraL family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 transmembrane" amino acids 117 to 138 (22 residues), see Phobius details TIGR00096: 16S rRNA (cytidine(1402)-2'-O)-methyltransferase" amino acids 7 to 275 (269 residues), 263.1 bits, see alignment E=1.4e-82 PF00590: TP_methylase" amino acids 7 to 206 (200 residues), 113.3 bits, see alignment E=1.6e-36 PF23016: RsmI_C" amino acids 231 to 277 (47 residues), 64.1 bits, see alignment 8.1e-22

Best Hits

Swiss-Prot: 53% identical to RSMI_ECOLI: Ribosomal RNA small subunit methyltransferase I (rsmI) from Escherichia coli (strain K12)

KEGG orthology group: K07056, (no description) (inferred from 70% identity to dar:Daro_0504)

MetaCyc: 53% identical to 16S rRNA 2'-O-ribose C1402 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11637 [EC: 2.1.1.198]

Predicted SEED Role

"rRNA small subunit methyltransferase I" in subsystem Heat shock dnaK gene cluster extended

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.198

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMU0 at UniProt or InterPro

Protein Sequence (280 amino acids)

>Dsui_0251 putative S-adenosylmethionine-dependent methyltransferase, YraL family (Dechlorosoma suillum PS)
MTIESALYVVPTPLGNLQDMSLRAIEVLKAVPWVAAEDTRHSQPLLRHFGSGARLLPAHQ
HNEEQAAQGVIDKLAAGEAVALVSDAGTPAVSDPGARIVARVREAGFKVVPLPGACAAVT
ALSASGLMAPHFLFYGFLPAKAGQRQKELEALVALPYTLVFYEAPHRVLESVEALAAAFG
PERTIVFARELTKLFETIHACPLGEALEWLQADANRQRGEFVLLVEAAPEDADDGAGERV
LRLLLAEGLPVKQCAKLAAEITGASKNELYQKALALKDAG