Protein Info for Dsui_0244 in Dechlorosoma suillum PS

Annotation: cell division protein FtsL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 89 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF04999: FtsL" amino acids 3 to 82 (80 residues), 80.7 bits, see alignment E=3.2e-27 TIGR02209: cell division protein FtsL" amino acids 3 to 82 (80 residues), 85.4 bits, see alignment E=9.9e-29

Best Hits

Swiss-Prot: 35% identical to FTSL_XANCP: Cell division protein FtsL (ftsL) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K03586, cell division protein FtsL (inferred from 78% identity to dar:Daro_3505)

Predicted SEED Role

"Cell division protein FtsL" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMT4 at UniProt or InterPro

Protein Sequence (89 amino acids)

>Dsui_0244 cell division protein FtsL (Dechlorosoma suillum PS)
MLRLNLFLLLAAMICALGVVTSQHKARKLFQELEGEQERARSLDVEWGQLQLELSTWATH
PRIEKIARDKLHMHAPEPAKVINVPAGGR