Protein Info for Dsui_0241 in Dechlorosoma suillum PS

Annotation: UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 transmembrane" amino acids 297 to 319 (23 residues), see Phobius details PF01225: Mur_ligase" amino acids 24 to 95 (72 residues), 31.4 bits, see alignment E=3.1e-11 TIGR01143: UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase" amino acids 27 to 456 (430 residues), 443.9 bits, see alignment E=3.1e-137 PF08245: Mur_ligase_M" amino acids 109 to 304 (196 residues), 151.3 bits, see alignment E=5.4e-48 PF02875: Mur_ligase_C" amino acids 326 to 445 (120 residues), 75 bits, see alignment E=1.5e-24

Best Hits

KEGG orthology group: K01929, UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase [EC: 6.3.2.10] (inferred from 63% identity to azo:azo0880)

Predicted SEED Role

"UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase (EC 6.3.2.10)" in subsystem Methicillin resistance in Staphylococci or Peptidoglycan Biosynthesis (EC 6.3.2.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMT1 at UniProt or InterPro

Protein Sequence (469 amino acids)

>Dsui_0241 UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase (Dechlorosoma suillum PS)
MMDLFEVARATNGTAYGSNVLFGGVSTDSRSVGRGELFVALRGERFDGHEYLAQAGERGA
CAAVVAVDTVEQLQGKVSLPLVAVADTRLALGALAGYWRAKFSLPLIAVTGSNGKTSTKE
MIASILQAQAVLDGYDPAMVVLATQGNFNNDIGLPLTLLKLRTTHRSGVIEMGMNHPGEI
GYLTRLAQPTVALVTNAQRAHLEGMGDLQQVAEEKATIYAGLKPGGVALVSADDAFAAYW
KGVNERRRVVTFGLDKPADVGGKVQLHGLETRIDLTSPKGNAAIRLRVPGLHNARNAVAA
AAAALAGGISLAAVVGGLESFRGVKGRLQQRQAAAGAVILDDTYNANPDSVRAGIDVLAA
TVGRKILVLGDMGEIGAMSGQYHDEIGGYAKSQGVDQLHCLGEAAAQAARNFGAGGHHYK
NLEALVQAVQAELTGDTTVLVKGSRFMKMERVVDALTAPAANQNSKENS