Protein Info for Dsui_0238 in Dechlorosoma suillum PS

Annotation: cell division protein FtsW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 57 to 80 (24 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 154 to 170 (17 residues), see Phobius details amino acids 176 to 193 (18 residues), see Phobius details amino acids 200 to 220 (21 residues), see Phobius details amino acids 277 to 301 (25 residues), see Phobius details amino acids 317 to 337 (21 residues), see Phobius details amino acids 352 to 375 (24 residues), see Phobius details TIGR02614: cell division protein FtsW" amino acids 18 to 378 (361 residues), 411.3 bits, see alignment E=1.7e-127 PF01098: FTSW_RODA_SPOVE" amino acids 20 to 380 (361 residues), 342.3 bits, see alignment E=1.6e-106

Best Hits

Swiss-Prot: 71% identical to FTSW_AROAE: Probable peptidoglycan glycosyltransferase FtsW (ftsW) from Aromatoleum aromaticum (strain EbN1)

KEGG orthology group: K03588, cell division protein FtsW (inferred from 80% identity to app:CAP2UW1_0572)

Predicted SEED Role

"Cell division protein FtsW" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMS8 at UniProt or InterPro

Protein Sequence (388 amino acids)

>Dsui_0238 cell division protein FtsW (Dechlorosoma suillum PS)
MSMVQALNQPRQEPTEVDMLLLWSVLGLLALGLVMVYSSSIATAEGSKAFGYQPAYFLIR
HGVFLCVAMVAAAVAFQVPVKVWQELAPWLFLTGAVLLAVVLIPGIGRDVNGARRWLPLG
FANLQPSELMKLFAVLYAADYTVRKMPHMHDLKKAFLPMAGAMVVIGGLLLKEPDFGAFV
VIISIAIGILFLGGMRARLFAVLFVVLLAAFAILIIVSPYRRDRLFGFMDPWSDAFGKGY
QLSHALIAFGRGELFGVGLGGSVEKLFYLPEAHTDFLLAVIAEELGFVGVLVVVGLFALL
VQRAFAIGRQAVALERLYPALVAMGIGIWMGVQSFINMGVNMGLLPTKGLTLPLMSFGGS
GVLANCVALAILLRVDWENRQLMRGGKV