Protein Info for Dsui_0236 in Dechlorosoma suillum PS

Annotation: UDP-N-acetylmuramate--alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 TIGR01082: UDP-N-acetylmuramate--L-alanine ligase" amino acids 7 to 459 (453 residues), 556 bits, see alignment E=3.8e-171 PF01225: Mur_ligase" amino acids 7 to 105 (99 residues), 110.3 bits, see alignment E=7.3e-36 PF08245: Mur_ligase_M" amino acids 110 to 293 (184 residues), 89.9 bits, see alignment E=3.4e-29 PF02875: Mur_ligase_C" amino acids 315 to 451 (137 residues), 70.1 bits, see alignment E=4.9e-23

Best Hits

Swiss-Prot: 82% identical to MURC_DECAR: UDP-N-acetylmuramate--L-alanine ligase (murC) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K01924, UDP-N-acetylmuramate--alanine ligase [EC: 6.3.2.8] (inferred from 82% identity to dar:Daro_3497)

Predicted SEED Role

"UDP-N-acetylmuramate--alanine ligase (EC 6.3.2.8)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMS6 at UniProt or InterPro

Protein Sequence (467 amino acids)

>Dsui_0236 UDP-N-acetylmuramate--alanine ligase (Dechlorosoma suillum PS)
MKHKIKHLHFVGIGGSGMSGIAEVMLNLGYQVSGSDLGENAATARLTAQGAKVIKGHDAA
NIAGADAVVVSTAVKADNPEVVAAREAHIPVVPRAQMLAELMRLKQGIAVAGTHGKTTTT
SLVASILAEGGLDPTFVIGGRLNAAGANARLGSGDFLVAEADESDASFLLLSPVISIVTN
IDADHMETYGHDFGRLKGAFVDFLNRLPFYGVAVLCVDDPNVREILPQVPKQVIRYGLDP
ATCNVYAENIVEAGGQMKFDAVRVNGSTTRLPITLNLPGRHYVLNALAAIAVATEVGVAD
EAIVTALAEFKGVGRRFQRYGEVACPTGGSFTLVDDYGHHPVEMAATLAAARGAFPGRRL
VLAFQPHRYSRTRDCFEDFVKVLSTVDTLLLADVYAAGEQPIVAADGRALARALRVGGKV
EPVFVEDIAAMQQTILDCVRDGDVVLTMGAGSIGGIPAKLAAQPAAK