Protein Info for Dsui_0234 in Dechlorosoma suillum PS

Annotation: cell division septal protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF08478: POTRA_1" amino acids 37 to 106 (70 residues), 61.3 bits, see alignment E=9.3e-21 PF03799: FtsQ_DivIB_C" amino acids 110 to 230 (121 residues), 78.8 bits, see alignment E=5.9e-26

Best Hits

Swiss-Prot: 38% identical to FTSQ_BURPS: Cell division protein FtsQ (ftsQ) from Burkholderia pseudomallei (strain K96243)

KEGG orthology group: K03589, cell division protein FtsQ (inferred from 60% identity to dar:Daro_3495)

Predicted SEED Role

"Cell division protein FtsQ" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMS4 at UniProt or InterPro

Protein Sequence (244 amino acids)

>Dsui_0234 cell division septal protein (Dechlorosoma suillum PS)
MWHKPQLMTAVADLLLAAGAAALLVALGLGAARLPLFPLKEVVFAQELREVQRGEVERAL
SGLVRGNFFSVNLDALRTALEKLPWVRKAEVRRAWPSRLEVRVEEHRPAARWGEGSGQLV
NTYGEVFAASLPQSRGEGLPQLNGPIGTAPDVLRRFDEFSRQLQPTGRQPLQLVLSPRLA
WQLKLDDGMVLELGREQPKAPVGQRLSRFIEIYHTVLAERTPRPQVVDLRYPNGFALRLA
AAGK