Protein Info for Dsui_0227 in Dechlorosoma suillum PS

Annotation: preprotein translocase, SecA subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 905 PF07517: SecA_DEAD" amino acids 6 to 396 (391 residues), 447.1 bits, see alignment E=8.1e-138 TIGR00963: preprotein translocase, SecA subunit" amino acids 28 to 821 (794 residues), 1130.1 bits, see alignment E=0 PF01043: SecA_PP_bind" amino acids 232 to 353 (122 residues), 130.9 bits, see alignment E=9.4e-42 PF21090: P-loop_SecA" amino acids 412 to 617 (206 residues), 306 bits, see alignment E=3.6e-95 PF07516: SecA_SW" amino acids 619 to 833 (215 residues), 238.1 bits, see alignment E=2.9e-74 PF02810: SEC-C" amino acids 885 to 903 (19 residues), 40.2 bits, see alignment (E = 7.1e-14)

Best Hits

Swiss-Prot: 76% identical to SECA_AZOSB: Protein translocase subunit SecA (secA) from Azoarcus sp. (strain BH72)

KEGG orthology group: K03070, preprotein translocase subunit SecA (inferred from 77% identity to app:CAP2UW1_1177)

Predicted SEED Role

"Protein export cytoplasm protein SecA ATPase RNA helicase (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMR7 at UniProt or InterPro

Protein Sequence (905 amino acids)

>Dsui_0227 preprotein translocase, SecA subunit (Dechlorosoma suillum PS)
MIPGLLKKIFGSRNDRLIKQYSQIVQKINGFEAAISALSDDALRGKTDEFRQRYAQGETL
DDLLPEAFAVVREAGKRVLGMRHFDVQMIGGMVLHYGKIAEMRTGEGKTLVATLPSYLNA
ISGKGVHVITVNDYLAQRDAEWMGRLHRFLGLSVGVNLSQMPHEQKQAAYAADITYGTNN
EFGFDYLRDNMVYAAGERVQRGLNFAIVDEVDSILIDEARTPLIISGQAEDHTELYQRMN
QVVPLLTRAADENSEGDYWVDEKGHQVHMSEQGHEHAEEILARVGLLEEGRSLYEAANII
LVHHLNAALRAHNLFHKDQQYVVQNGEIIIVDEFTGRLMPGRRWSEGLHQSVEAKEGVRI
QNENQTLASITFQNYFRMYGKLAGMTGTADTEAYEFMEIYGLETVVIPTHRPAQRKDHND
QVFRTAAEKFAAMKADILDCHQRGQPVLVGTTSIENSELLSRLLDQEKLPHQVLNAKQHG
KEAEIVAQAGRPGMITIATNMAGRGTDIVLGGSIEKQIDAVRLDESLDDAAKEARIAALK
AEWQPVHDQVLAAGGLHIIGSERHESRRIDNQLRGRAGRQGDPGSSRFYLSLDDPLLRIF
AGDRLKAIMERLKMPEGEAIEHPLVTRSLESAQRKVEARNFDMRKQLLEYDDVANDQRKV
IYAQRNDLLEVDDISETIQAMRQGVVADLFHLYVPPDSVEEQWDLPGLEKALEAEFLLTL
PVAEWVQADTTLSVEDLLHRVIAAADQAYADKVALVSDPSVFRKFERDVMLQSLDSHWRE
HLAALDHLRQGIHLRGYAQKNPKQEYKREAFELFEGLLNSIRNEVSKLLLTVQVRSPEDV
SEVEQPGVENVQYHHADYDEVLGTADGEGEEAGQQPAQAGPKVGRNDPCPCGSGKKYKHC
HGKLN