Protein Info for Dsui_0224 in Dechlorosoma suillum PS

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 PF00126: HTH_1" amino acids 3 to 62 (60 residues), 74.7 bits, see alignment E=4.5e-25 PF03466: LysR_substrate" amino acids 87 to 289 (203 residues), 152.3 bits, see alignment E=1.2e-48

Best Hits

Swiss-Prot: 38% identical to OXYR_PECCC: Hydrogen peroxide-inducible genes activator (oxyR) from Pectobacterium carotovorum subsp. carotovorum

KEGG orthology group: K04761, LysR family transcriptional regulator, hydrogen peroxide-inducible genes activator (inferred from 55% identity to mfa:Mfla_0020)

MetaCyc: 36% identical to DNA-binding transcriptional dual regulator OxyR (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Hydrogen peroxide-inducible genes activator" in subsystem DNA-binding regulatory proteins, strays or Oxidative stress or Thioredoxin-disulfide reductase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMR4 at UniProt or InterPro

Protein Sequence (301 amino acids)

>Dsui_0224 transcriptional regulator (Dechlorosoma suillum PS)
MTLTELRYIVALAQEGRFSRAAERCSVSQPTLSVAIQRLEEDLGVILFERGKGQVTLTDV
GEQVVAQAARALEEADRVRQIAHRGRNQLEGGLKLGVIHTIGPYLLPELIVSLRQIAPDM
PLAIEENMTATLADMLRHGEVDAAILALPFELPGVVTRPLYDEPFKVVVPQGHPWQDKQE
IASDEVDAEEVLLLKAGNCFRDQVMDACPQISGSDTEVRQGHSIETIRCMVASGFGLSVL
PAGALCKPYSTDLISVVPFKAPAPSRRVALAWRVGFTRPKAVEALCQAVSLIDNPSYLHV
R