Protein Info for Dsui_0223 in Dechlorosoma suillum PS

Annotation: methylase involved in ubiquinone/menaquinone biosynthesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13649: Methyltransf_25
  • amino acids 40 to 129 (90 residues), 64.8 bits, E=2.4e-21
• PF08242: Methyltransf_12
  • amino acids 43 to 130 (88 residues), 42.6 bits, E=2.1e-14
• PF08241: Methyltransf_11
  • amino acids 43 to 133 (91 residues), 71.3 bits, E=2.2e-23
• PF13847: Methyltransf_31
  • amino acids 55 to 135 (81 residues), 42.2 bits, E=1.9e-14
• PF01209: Ubie_methyltran
  • amino acids 59 to 134 (76 residues), 25.8 bits, E=1.6e-09

Best Hits

KEGG orthology group: K00551, phosphatidylethanolamine N-methyltransferase [EC: 2.1.1.17] (inferred from 65% identity to dar:Daro_3485)

Predicted SEED Role

"probable phosphatidylethanolamine N-methyltransferase"

MetaCyc Pathways

• phosphatidylcholine biosynthesis V (1/3 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.17

Sequence Analysis Tools

See G8QMR3 at UniProt or InterPro

Protein Sequence (197 amino acids)

>Dsui_0223 methylase involved in ubiquinone/menaquinone biosynthesis (Dechlorosoma suillum PS)
MGLQHSYALIAPFYDAALAAATRGARRQSLGALPQPPSDVLLLGIGTGLDLPHLPRQHRY
TGLDLTPAMLARACRRSDGLDFAPVRGDARRLPFADAAFDAVVLHLILAVVPEPRLCLQE
TARVLRPGGTALIFDKFLQPGQRAPLRRLLSPLASRLATHLDVVFETVHESEPALQLESD
RPALAAGWFRLIRLRRR