Protein Info for Dsui_0219 in Dechlorosoma suillum PS

Annotation: anthranilate synthase component I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 491 PF04715: Anth_synt_I_N" amino acids 26 to 169 (144 residues), 103.5 bits, see alignment E=1.2e-33 TIGR00564: anthranilate synthase component I" amino acids 26 to 479 (454 residues), 573.7 bits, see alignment E=1.6e-176 PF00425: Chorismate_bind" amino acids 219 to 471 (253 residues), 324 bits, see alignment E=7.7e-101

Best Hits

Swiss-Prot: 64% identical to TRPE_NEIMA: Anthranilate synthase component 1 (trpE) from Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)

KEGG orthology group: K01657, anthranilate synthase component I [EC: 4.1.3.27] (inferred from 84% identity to dar:Daro_3481)

Predicted SEED Role

"Anthranilate synthase, aminase component (EC 4.1.3.27)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Tryptophan synthesis (EC 4.1.3.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.27

Use Curated BLAST to search for 4.1.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMQ9 at UniProt or InterPro

Protein Sequence (491 amino acids)

>Dsui_0219 anthranilate synthase component I (Dechlorosoma suillum PS)
MTETEFNALAAQGYNRIPVTLETFADLDTPLSIYLKLANGPYTYLLESVQGGERFGRYSI
IGLASPTRIAVYGHQVMVLTGQRIAERENDTNPLEFIESYQKRFRVAPYAGLPRFCGGLV
GCFGYDTVRYVETRLTKSAKHDELGTPDILLLLSEEIAVVDNLSGKLTLVVYAEPGFPGA
FQKARARLKELLAQLRTPAPIPEEKPATSQPAVSIFGEAPFKQAVAKAKEYITEGDIMQV
VLSQRMTKPFSASPLSLYRALRTLNPSPYMYYFDFEDFHVVGASPEILTRLEGDTVTVRP
IAGTRKRGATPEEDAALAEDLLADQKEIAEHVQLLDLGRNDVGRVAQTGSVKLTERMSIE
RYSHVMHIVSNVEGKLQAGLSALDVLKAAFPAGTLSGAPKVRAMEIIDELEPVKRGIYGG
AIGYLGFNGDMDLAIAIRTAVIKDGQLHVQAGAGIVADSDPTSEWQETQNKARAVLRAAE
MAENGLDTRFE