Protein Info for Dsui_0156 in Dechlorosoma suillum PS

Annotation: thiosulfate reductase cytochrome B subunit (membrane anchoring protein)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 125 to 145 (21 residues), see Phobius details amino acids 165 to 187 (23 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 9 to 197 (189 residues), 83.7 bits, see alignment E=7.1e-28

Best Hits

Swiss-Prot: 100% identical to YEDZ1_AZOOP: Putative protein-methionine-sulfoxide reductase subunit YedZ1 (yedZ1) from Azospira oryzae (strain ATCC BAA-33 / DSM 13638 / PS)

KEGG orthology group: None (inferred from 73% identity to dar:Daro_2591)

Predicted SEED Role

"Thiosulfate reductase cytochrome B subunit (membrane anchoring protein)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QM62 at UniProt or InterPro

Protein Sequence (198 amino acids)

>Dsui_0156 thiosulfate reductase cytochrome B subunit (membrane anchoring protein) (Dechlorosoma suillum PS)
MSKEIYAIHPPWLRVTHWLYVVAVVILVMSGWRIYDASPFFPFFIPKEITLGGWLGGALQ
WHFAAMWLLAVNGLIYLFFNIFSGRLWHKFFPLSLRAIVADLLDALKGKLSHADLSHYNA
LQRAAYLFAIADIIVIVLSGLVLWKSVQFPILRELLGGYEAARRVHFIGMSALVAFVGVH
VAMVALVPRTLIAMIRGH