Protein Info for Dsui_0151 in Dechlorosoma suillum PS

Annotation: signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 549 transmembrane" amino acids 239 to 259 (21 residues), see Phobius details PF00672: HAMP" amino acids 259 to 307 (49 residues), 46.3 bits, see alignment 6.6e-16 PF00512: HisKA" amino acids 318 to 381 (64 residues), 47.4 bits, see alignment E=2.4e-16 PF02518: HATPase_c" amino acids 427 to 535 (109 residues), 87.7 bits, see alignment E=1.1e-28

Best Hits

KEGG orthology group: None (inferred from 93% identity to dar:Daro_2586)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QM57 at UniProt or InterPro

Protein Sequence (549 amino acids)

>Dsui_0151 signal transduction histidine kinase (Dechlorosoma suillum PS)
MMEENTEPSVDGFQKVADQLDIMMRERHAYRQVKMLLDSGTGSHRVLVSLRNDNVVHTMV
DQPTANWNFESLLAEKQGLRNFNEQTRNLSDETSGERVFFVSIPVRGKDRNVIGAIAVVV
AIDQVFRTLGKAHDGIAYWIADSDGQYLYQSRPETSGSHTQKAANAIRDFQLAQTWDQVL
SGAKPQLIMEFPAIATMLGIRRATLNVGEGNEIENVLVVGGVISLVELEIKAAALQRQLA
IAVASIGLLMLLTLSVSTSRLLRPIDVLIKAANRIASGDQNIVIPANNNDEIGTLSRAMT
RMAEKLRLAGKNSEQSAMGQMASMIAHDLRNALSSVKMNLQILDEHHRKEGDMQIENCEI
ALRQVRYMETILNDMLTYARPGTAEFDWVDLGDTLRAASVSLLPEITGKSVEVRMEGEEK
LPTIMADRNKLLQLFQNVLGNAIYAVPEWGLITIRTRCLLHESQPSVEIRFEDDGPGISP
QIADKVFDPFFTTNARGTGLGLAIVQRIVAQHRGRVYLDSERGHGTTVVVVLPLTQEGTD
DSPQSGELS