Protein Info for Dsui_0150 in Dechlorosoma suillum PS

Annotation: response regulator with CheY-like receiver, AAA-type ATPase, and DNA-binding domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 PF00072: Response_reg" amino acids 10 to 119 (110 residues), 94.9 bits, see alignment E=1.6e-30 PF00158: Sigma54_activat" amino acids 149 to 315 (167 residues), 218.2 bits, see alignment E=2.6e-68 PF14532: Sigma54_activ_2" amino acids 150 to 320 (171 residues), 71.9 bits, see alignment E=3.2e-23 PF07724: AAA_2" amino acids 171 to 297 (127 residues), 29.9 bits, see alignment E=2.5e-10 PF00004: AAA" amino acids 174 to 290 (117 residues), 25.8 bits, see alignment E=5.8e-09 PF07728: AAA_5" amino acids 174 to 291 (118 residues), 30.9 bits, see alignment E=1.2e-10 PF25601: AAA_lid_14" amino acids 321 to 396 (76 residues), 85.6 bits, see alignment E=7.4e-28 PF02954: HTH_8" amino acids 416 to 457 (42 residues), 41.2 bits, see alignment 4.9e-14

Best Hits

KEGG orthology group: None (inferred from 93% identity to dar:Daro_2585)

Predicted SEED Role

"Response regulator of zinc sigma-54-dependent two-component system" in subsystem Zinc resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QM56 at UniProt or InterPro

Protein Sequence (468 amino acids)

>Dsui_0150 response regulator with CheY-like receiver, AAA-type ATPase, and DNA-binding domains (Dechlorosoma suillum PS)
MAGDRELIHILIVDDDVAICQTLKSHFQKSAFQVSLVNTAEEGINVALSSNIDAIISDIR
LPAKGGLDLLREVKAEKPELPIIMITAFHDMEMTVAAMQCGAMDYVPKPIDLPELDAAVS
RALFASSRSEHVTGDPLIIGATDVTPTQIVGQSFAMKEVFKTIALVAQSRVTALILGESG
TGKELVARAIHNASAEKDMPFIAVNCAALVDSLLESELFGHERGAFTGAVNAHKGKVEQV
GEGTLFLDEVAELSPLIQGKLLRILEAREYSPVGSAQVKKSKARFIAATNVDLQARVASG
EFREDLFYRLNVASINLPPLRERQGDIPRLIDFLLRKINRDLRKNIRRVSGEAMACLNAF
AWPGNVRQLENVLMKAAVMERGDTLTIDRLPPEIRCSRMPISASGIDASIPKNLLSLREM
EKNHIVHVLEKTGWHKGQACEILDISRPKLERRINEFNLSPPDRTSGN