Protein Info for Dsui_0148 in Dechlorosoma suillum PS

Annotation: DMSO reductase family type II enzyme, iron-sulfur subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 TIGR03478: DMSO reductase family type II enzyme, iron-sulfur subunit" amino acids 10 to 328 (319 residues), 552.1 bits, see alignment E=1.7e-170 PF13247: Fer4_11" amino acids 130 to 224 (95 residues), 115.1 bits, see alignment E=3.7e-37 PF13237: Fer4_10" amino acids 134 to 181 (48 residues), 26.1 bits, see alignment 1.7e-09 PF12838: Fer4_7" amino acids 137 to 182 (46 residues), 29.4 bits, see alignment 2.3e-10

Best Hits

Swiss-Prot: 95% identical to PCRB_DECAR: Perchlorate reductase subunit beta (pcrB) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K00371, nitrate reductase 1, beta subunit [EC: 1.7.99.4] (inferred from 95% identity to dar:Daro_2583)

MetaCyc: 82% identical to perchlorate reductase beta subunit (Dechloromonas agitata)
1.97.1.-

Predicted SEED Role

"Respiratory nitrate reductase beta chain (EC 1.7.99.4)" in subsystem Nitrate and nitrite ammonification (EC 1.7.99.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.7.99.4

Use Curated BLAST to search for 1.7.99.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QM54 at UniProt or InterPro

Protein Sequence (333 amino acids)

>Dsui_0148 DMSO reductase family type II enzyme, iron-sulfur subunit (Dechlorosoma suillum PS)
MANVMKAPRRQLTYVTDLNKCIGCQTCTVACKKLWTTGPGQDFMYWRNVETAPGLGYPRN
WQTKGGGYKNGELQKGKIPPMIDYGIPFEFDYAGRLFEGKPGRVRPSPTPRSAPNWDEDQ
GAGEYPNNSFFYLPRMCNHCTKPACLEACPNEAIYKREQDGIVVIHQDKCKGAQACVQSC
PYAKPYFNPLTNKANKCIGCFPRIEQGVAPACVAQCVGRAMHVGFVDDVNSSVYKLIKQY
KVALPLHPEFGTEPNVFYVPPVLGPRIEMANGEPSTDPKIPLAQLEGLFGKQVRDVLAIL
QSEREKKMKGLASDLMDVLIGRRSTDMMISPLT