Protein Info for Dsui_0135 in Dechlorosoma suillum PS

Annotation: response regulator with CheY-like receiver, AAA-type ATPase, and DNA-binding domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 PF00072: Response_reg" amino acids 17 to 126 (110 residues), 90.2 bits, see alignment E=2.5e-29 PF00158: Sigma54_activat" amino acids 150 to 315 (166 residues), 235.2 bits, see alignment E=8.6e-74 PF14532: Sigma54_activ_2" amino acids 150 to 320 (171 residues), 96.8 bits, see alignment E=3.4e-31 PF02954: HTH_8" amino acids 414 to 453 (40 residues), 43.7 bits, see alignment 4.4e-15

Best Hits

KEGG orthology group: K02667, two-component system, NtrC family, response regulator PilR (inferred from 63% identity to cvi:CV_0073)

Predicted SEED Role

"Type IV fimbriae expression regulatory protein PilR" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QM42 at UniProt or InterPro

Protein Sequence (457 amino acids)

>Dsui_0135 response regulator with CheY-like receiver, AAA-type ATPase, and DNA-binding domains (Dechlorosoma suillum PS)
MAQAKSERRARGALARVLVVDDEADIRELVDLTLSRMGLAADCAGTVAEAREFLARESYQ
LCLTDMRLPDGEGLELVRLIGEQYSETPVAVITAFGSTENAVAALKAGAFDYLAKPVALD
QLRTLIKSAIDLPVASAAEGAPRSEALQLLGDSRAMSTVREIIAKLARSQAPVYISGESG
CGKELAARLIHEQSNRSQAPFVPVNCGAIPENLMESEFFGYRKGAFTGAEQDREGFFQAA
GGGTLFLDEVADLPLSMQVKLLRAIQEKRVRKVGATVEEAVDVRLICATHQDLKACVEAG
TFRQDLYYRLNVIELRMPPLRERAEDIPQLARACLDRLAHQASALPLTSAAEAALCRYTF
PGNVRELENILERATALCSGSEIDEGDLQLSLADDGHPDAGSEGRGGESLDTYLDRLERQ
AIQEAVVQTQGNRTAAARLLGITFRSLRYRMARLGIE