Protein Info for Dsui_0134 in Dechlorosoma suillum PS

Annotation: negative regulator of beta-lactamase expression

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 PF01510: Amidase_2" amino acids 28 to 168 (141 residues), 120.1 bits, see alignment E=4.2e-39

Best Hits

Swiss-Prot: 64% identical to AMPD_CITFR: 1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD (ampD) from Citrobacter freundii

KEGG orthology group: K03806, AmpD protein (inferred from 72% identity to tmz:Tmz1t_1087)

MetaCyc: 63% identical to 1,6-anhydro-N-acetylmuramoyl-L-alanine amidase (Escherichia coli K-12 substr. MG1655)
N-acetylmuramoyl-L-alanine amidase. [EC: 3.5.1.28]

Predicted SEED Role

"N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) AmpD" (EC 3.5.1.28)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.28

Use Curated BLAST to search for 3.5.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QM41 at UniProt or InterPro

Protein Sequence (190 amino acids)

>Dsui_0134 negative regulator of beta-lactamase expression (Dechlorosoma suillum PS)
MTERFDAEGWLAGAVRRESPNQDERPEGERPSLVVIHAISLPPDDFGGPWIFDLFDNTLD
PAAHPYFASIHHLRVSSHFLIRRDGELVQFVSCDKRAWHAGVSEWLGRERCNDFSIGIEL
EGCDAMPFEPAQYDALKALLQAILRHYPISAVAGHCHIAPQRKTDPGPHFDWQQLRCEFA
TVRFPAMQKS