Protein Info for Dsui_0128 in Dechlorosoma suillum PS

Annotation: D-alanyl-D-alanine carboxypeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF00768: Peptidase_S11" amino acids 86 to 310 (225 residues), 199.5 bits, see alignment E=6.3e-63 PF13354: Beta-lactamase2" amino acids 96 to 236 (141 residues), 41.6 bits, see alignment E=9.6e-15

Best Hits

KEGG orthology group: K07262, D-alanyl-D-alanine endopeptidase (penicillin-binding protein 7) [EC: 3.4.21.-] (inferred from 51% identity to mei:Msip34_0243)

Predicted SEED Role

"Murein-DD-endopeptidase (EC 3.4.99.-)" in subsystem Peptidoglycan Biosynthesis (EC 3.4.99.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-, 3.4.99.-

Use Curated BLAST to search for 3.4.21.- or 3.4.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QM35 at UniProt or InterPro

Protein Sequence (339 amino acids)

>Dsui_0128 D-alanyl-D-alanine carboxypeptidase (Dechlorosoma suillum PS)
MRKTFIPALLLGLAAVAVAVPPAAEASQSKARKTSKSAPAAKAAKPVKASTSKPATASKP
KVISQNVRNSNVRRASAVPADFGEAQRLAVQSSAALVLDQGNGEVIYQKNASAVVPIASI
TKLMTAMVVLDSQPNLSAPVTIGEEDIDTLKGSRSRLSVGTVLTREHALLLALMSSENRA
AHTLARHYPGGLHAFVEAMNRKARSLGMMDTHFQDPTGLTSNNVSTANDLAKMVAAAHTY
PLIREFSTTSGAMVETNGRLLEYHNTNALVKSTTWDIGLSKTGYIQEAGKCLVMQARVAE
RPVVIVLLDSAGKMTRIGDANRIKRWMESASLGRRTSRA