Protein Info for Dsui_0121 in Dechlorosoma suillum PS

Annotation: glutamyl-tRNA reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR01035: glutamyl-tRNA reductase" amino acids 6 to 406 (401 residues), 435.2 bits, see alignment E=1.3e-134 PF05201: GlutR_N" amino acids 8 to 154 (147 residues), 185.3 bits, see alignment E=1.5e-58 PF01488: Shikimate_DH" amino acids 170 to 309 (140 residues), 153.4 bits, see alignment E=1e-48 PF03807: F420_oxidored" amino acids 182 to 229 (48 residues), 21.7 bits, see alignment 6.6e-08 PF00745: GlutR_dimer" amino acids 323 to 419 (97 residues), 95.4 bits, see alignment E=5.7e-31

Best Hits

Swiss-Prot: 76% identical to HEM1_DECAR: Glutamyl-tRNA reductase (hemA) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K02492, glutamyl-tRNA reductase [EC: 1.2.1.70] (inferred from 76% identity to dar:Daro_3689)

MetaCyc: 44% identical to glutamyl-tRNA reductase (Escherichia coli K-12 substr. MG1655)
Glutamyl-tRNA reductase. [EC: 1.2.1.70]

Predicted SEED Role

"Glutamyl-tRNA reductase (EC 1.2.1.70)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.70

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QM28 at UniProt or InterPro

Protein Sequence (423 amino acids)

>Dsui_0121 glutamyl-tRNA reductase (Dechlorosoma suillum PS)
MSLALFTLGINHHSAPVSVREQVAFHAETLSEALAGLVRAKPVKEAAILSTCNRTELYCA
TETPEAAADWLAEYHRLPRSTIQPYLYTLPQPEAVRHAFRVASGLDSMVIGEPQILGQMK
DAVRVAEEAGTLGTMLNKLFQRSFAVAKEVRSTTAIGANIVSMAAAGVHLAERIFESVAD
QRILFIGAGEMIELCATHFAAQKPKQVTIANRTVERGQALADRLAADGIPTTAIRLDALA
EHLPQYDIVVSCTASPLPIIGLGMMERTVKARRHKPVFMVDLAVPRDIESEVGELDDVFL
YTVDDLAQVVEAGLESRQAAVVEAESIITTQVGQFLHWLDTRDSVPVIRALRDSAERMRR
HEMEHALKLLAKGENPEKVLEALSQRLTNKFLHAPTQVLGQAGEERGELQHLITRLFHLH
HGE