Protein Info for Dsui_0119 in Dechlorosoma suillum PS

Annotation: protein-(glutamine-N5) methyltransferase, release factor-specific

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 TIGR00536: methyltransferase, HemK family" amino acids 19 to 277 (259 residues), 252.2 bits, see alignment E=5.3e-79 PF17827: PrmC_N" amino acids 22 to 77 (56 residues), 60.7 bits, see alignment E=7.4e-20 TIGR03534: protein-(glutamine-N5) methyltransferase, release factor-specific" amino acids 27 to 275 (249 residues), 298.4 bits, see alignment E=4.4e-93 PF06325: PrmA" amino acids 99 to 187 (89 residues), 32.9 bits, see alignment E=2.3e-11 PF00891: Methyltransf_2" amino acids 102 to 173 (72 residues), 24.3 bits, see alignment E=8.4e-09 PF05175: MTS" amino acids 108 to 195 (88 residues), 66.7 bits, see alignment E=9e-22 PF13847: Methyltransf_31" amino acids 117 to 196 (80 residues), 48.9 bits, see alignment E=2.9e-16 PF13649: Methyltransf_25" amino acids 118 to 187 (70 residues), 47.4 bits, see alignment E=1.1e-15 PF08241: Methyltransf_11" amino acids 119 to 187 (69 residues), 32.2 bits, see alignment E=6.2e-11

Best Hits

Swiss-Prot: 58% identical to PRMC_BURPS: Release factor glutamine methyltransferase (prmC) from Burkholderia pseudomallei (strain K96243)

KEGG orthology group: K02493, methyltransferase [EC: 2.1.1.-] (inferred from 60% identity to dar:Daro_3684)

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmC, methylates polypeptide chain release factors RF1 and RF2"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QM26 at UniProt or InterPro

Protein Sequence (281 amino acids)

>Dsui_0119 protein-(glutamine-N5) methyltransferase, release factor-specific (Dechlorosoma suillum PS)
MAAASGSAGLTRRQAVDQVRRRIAPLDARLLLQHCLGISHVEFLTRPDEPLAAADSEAFM
ALVMRRERGEPLAYLTGEREFFSRSFKVTPDVLIPRPDTELLVLQALERLKPLAWPRVVD
LGTGSGAIAVSIACEWPEAKVTAVDVSPAALAVARENAERLGARVEFRHSDWFTGLAGEQ
FELIVSNPPYVAAQDPHLSQNGLPFEPNGALTDGGDGLSCLRAIIEGAPAHLVPGGWLLL
EHGYDQAEKVRELLGAGGFKEVTSWSDLAGIERVSGGRLPD