Protein Info for Dsui_0079 in Dechlorosoma suillum PS

Annotation: pseudaminic acid synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03586: pseudaminic acid synthase
  • amino acids 19 to 345 (327 residues), 499.4 bits, E=2.3e-154
• PF03102: NeuB
  • amino acids 41 to 278 (238 residues), 294 bits, E=8.7e-92
• PF08666: SAF
  • amino acids 293 to 350 (58 residues), 47.1 bits, E=3e-16

Best Hits

KEGG orthology group: K01654, N-acetylneuraminate synthase [EC: 2.5.1.56] (inferred from 76% identity to rhi:NGR_b09490)

Predicted SEED Role

"N-acetylneuraminate synthase (EC 2.5.1.56)" in subsystem CMP-N-acetylneuraminate Biosynthesis or Sialic Acid Metabolism (EC 2.5.1.56)

MetaCyc Pathways

• CMP-N-acetylneuraminate biosynthesis II (bacteria) (2/3 steps found)
• superpathway of CMP-sialic acids biosynthesis (3/15 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.56

Sequence Analysis Tools

See G8QLH4 at UniProt or InterPro

Protein Sequence (351 amino acids)

>Dsui_0079 pseudaminic acid synthase (Dechlorosoma suillum PS)
MNSKEVIRIDGRAIGDTFPPYVIAELSANHNGRLETALRILEEAQKAGADAVKLQTYRPD
TITLDSSSEGFVIQGGLWDGRRLYDLYQEAHMPWEWHAPLFKRGRELGITVFSTPFDPTA
VDLLEDLNAPAYKIASFEAVDLPLIRYVASTGKPMIISTGMADAEEIAEAIAAAREGGCQ
QLAILHCVSGYPAPAADYNLRTIPDMMERFGLVTGLSDHTLDNTTAIASVALGACIIEKH
FTLDRLGGGPDDSFSLEPPELAALCQGARTAWEALGRVDYGRKSSEQGNAQFRRSLYYVR
DLDAGEIIGADAVRSVRPGFGLAPKHLDSVLGRRAARKIMRNTPVTPDSFE