Protein Info for Dsui_0058 in Dechlorosoma suillum PS

Annotation: Glycosyl transferase family 11

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 transmembrane" amino acids 119 to 137 (19 residues), see Phobius details PF01531: Glyco_transf_11" amino acids 129 to 288 (160 residues), 101 bits, see alignment E=3.8e-33

Best Hits

Predicted SEED Role

"Alpha-1,2-fucosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLF4 at UniProt or InterPro

Protein Sequence (311 amino acids)

>Dsui_0058 Glycosyl transferase family 11 (Dechlorosoma suillum PS)
MQSPACIAGARAWWVGYGMAEAMQPVVVGLSGGLGNQMFQYAAGRALAHRLGHPLSLDLS
WFQGRGDRHFALAPFHIAASLERAWPRLPPAMQAQLSRLSRRWAPRIMGAPVFREPHFHY
VPAFAALAAPVFLEGYWQSERYFRELREPLLQDFSLRQPLPASCQPILAAIGNSDAICVH
VRRGDYLSNPVAAKVHGVCPVDYYQQGVAELSASLARPHCFVFSDDPEWVRGSLAFPCPM
TVVDVNGPAEAHFDLALMAACQHFVIANSSLSWWGAWLGQAAGKRVIAPSRWFLTSDKDA
RDLLPPSWERR