Protein Info for Dsui_0055 in Dechlorosoma suillum PS

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 transmembrane" amino acids 15 to 33 (19 residues), see Phobius details PF13439: Glyco_transf_4" amino acids 35 to 171 (137 residues), 33.4 bits, see alignment E=1.3e-11 PF13579: Glyco_trans_4_4" amino acids 42 to 171 (130 residues), 44.2 bits, see alignment E=7.9e-15 PF20706: GT4-conflict" amino acids 213 to 342 (130 residues), 39.9 bits, see alignment E=8.3e-14 PF00534: Glycos_transf_1" amino acids 214 to 366 (153 residues), 105 bits, see alignment E=9.9e-34 PF13692: Glyco_trans_1_4" amino acids 215 to 353 (139 residues), 98.3 bits, see alignment E=1.5e-31

Best Hits

Predicted SEED Role

"Alpha-1,3-N-acetylgalactosamine transferase PglA (EC 2.4.1.-)" in subsystem N-linked Glycosylation in Bacteria (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLF1 at UniProt or InterPro

Protein Sequence (395 amino acids)

>Dsui_0055 glycosyltransferase (Dechlorosoma suillum PS)
MNLPDPAGDGRAAKPAIMFVATTPFAVNAFLATHLETLARHYRITLCVNLQAYELLPALA
RQVEVRHIPFVRKIAPWDDLRTLLQLLAVVRQVRPAVIHSITPKAGLLAMLAGFLARVPH
RWHTFTGQVWATRQGLGRRLLKAMDRLIVLLASRVFADSASQCRLLRDEGVVSGDGIGML
GAGSIAGVDLQRFHPDGAFRIALRQEVGCQPAACVFLFVGRLARDKGVFDLVRAFAQAAR
SAPGMELWVVGPNEEGLLPALQQAAADCPAPIRWLGATPTPERFMAAADVLVLPSYREGF
GSVIIEGAACGIPALAYRIDGVIDAVADGVSGELVAVGQVEALAAAMVRLATDDERRQTL
GRQARARAEGDFSSRTVTAAWLDYYQTQLDKGMHP